Search by BoMiProt ID - Bomi9949


Primary Information

BoMiProt ID Bomi9949
Protein Name Transcription initiation factor TFIID subunit 8/TBP-associated factor 8
Organism Bos taurus
Uniprot IdA7MAZ4
Milk FractionWhey
Ref Sequence Id NP_001094670.1
Aminoacid Length 310
Molecular Weight 34227
Fasta Sequence https://www.uniprot.org/uniprot/A7MAZ4.fasta
Gene Name TAF8
Gene Id 539938
Protein Existence Status reviewed

Secondary Information

Protein Function helps in the assembly of TFIID complex formation.transcription factor TFIID is a cornerstone of RNA polymerase II transcription initiation in eukaryotic cells. 
Biochemical Properties 310 amino acid protein harboring a histone fold domain (HFD) at its N-terminal end, which interacts with the HFD of TAF10, to form a noncanonical histone fold pair arrangement in TFIID.TAF8 also interacts with TAF2 and TAF2-TAF8-TAF10 subcomplex assembles in the cytoplasm.
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7MAZ4|TAF8_BOVIN Transcription initiation factor TFIID subunit 8 OS=Bos taurus OX=9913 GN=TAF8 PE=2 SV=1 MADAAATAGAAGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVET LTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVIT APPVTNQPVT*130PKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAA SQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEET DSSEQDEQTDTENLPLHISPDDSGAEKENTS*271VLQQNPSLSGSRNGEESIIDNPYLRPVKK PKIRRKKSLS
Predicted Disorder Regions 1-34, 115-205, 224-310
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Scheer E, Luo J, Bernardini A, Ruffenach F, Garnier JM, Kolb-Cheynel I, Gupta K, Berger I, Ranish J, Tora L. TAF8 regions important for TFIID lobe B assembly or for TAF2 interactions are required for embryonic stem cell survival. J Biol Chem. 2021 Nov;297(5):101288. doi: 10.1016/j.jbc.2021.101288. Epub 2021 Oct 9. PMID: 34634302; PMCID: PMC8564675.