Search by BoMiProt ID - Bomi9940


Primary Information

BoMiProt ID Bomi9940
Protein Name Transcription factor jun-D
Organism Bos taurus
Uniprot IdA7YY54
Milk FractionWhey
Ref Sequence Id NP_001096723.1
Aminoacid Length 347
Molecular Weight 35352
Fasta Sequence https://www.uniprot.org/uniprot/A7YY54.fasta
Gene Name JUND
Gene Id 517192
Protein Existence Status reviewed

Secondary Information

Protein Function Jun-D is involved in the activation of immediate early genes induced by growth factors and by tumor promoters. Several tumor promoter- and growth factor responsive genes are downstream of AP-1 binding sites.Ligand-induced modification of preexisting Jun-D could play a role in the activation of these genes.
Biochemical Properties Three members of the mammalian jun family jun C, jun-B, and jun-D. The three Jun proteins are closely related in amino acid sequence, particularly in the region (HR-2) containing the DNA-binding domain, the heptad leucine repeats, and domains for dimerization and interaction with Fos, and in the segment (HR-1) containing a putative transcription activation domain.
Significance in milk regulator of bovine milk fatty acid profile.
PTMs Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7YY54|JUND_BOVIN Transcription factor JunD OS=Bos taurus OX=9913 GN=JUND PE=2 SV=1 METPFYGDEALSGLGGGGSSSGGGGSFASPGRLFPGAPPTAAPGSMMKKDALTLSLSEQV AAALKPAAAPPPGPLRTDGAPGTAPPDGLLAS*92PELGLLKLAS*102PELERLIIQSNGLVTTT*119P TSTQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLSAGAASAAAAAGGPSGTAAGAAPPS ELAPAAATPEAPVYANLSSYAGGTGSAGGAATVAFAAEPVPFPPPPPPGTLGPPRLAALK DEPQTVPDVPS*251FGES*255PPLS*259PIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
Predicted Disorder Regions 5 disordered segments; (2-97), (123-192),(202-210), (262-294), (332-339)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Ryder K, Lanahan A, Perez-Albuerne E, Nathans D. jun-D: a third member of the jun gene family. Proc Natl Acad Sci U S A. 1989 Mar;86(5):1500-3. doi: 10.1073/pnas.86.5.1500. PMID: 2493644; PMCID: PMC286724.