Primary Information |
---|
BoMiProt ID | Bomi9940 |
---|
Protein Name | Transcription factor jun-D |
---|
Organism | Bos taurus |
---|
Uniprot Id | A7YY54 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001096723.1 |
---|
Aminoacid Length | 347 |
---|
Molecular Weight | 35352 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/A7YY54.fasta |
---|
Gene Name | JUND |
---|
Gene Id | 517192 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Jun-D is involved in the activation of immediate early genes induced by growth factors and by tumor promoters. Several tumor promoter- and growth factor responsive genes are downstream of AP-1 binding sites.Ligand-induced modification of preexisting Jun-D could play a role in the activation of these genes. |
---|
Biochemical Properties | Three members of the mammalian jun family jun C, jun-B, and jun-D. The three Jun proteins are closely related in amino acid sequence, particularly in the region (HR-2) containing the DNA-binding domain, the heptad leucine repeats, and domains for dimerization and interaction with Fos, and in the segment (HR-1) containing a putative transcription activation domain. |
---|
Significance in milk | regulator of bovine milk fatty acid profile. |
---|
PTMs | Phosphorylation on Ser and Thr |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A7YY54|JUND_BOVIN Transcription factor JunD OS=Bos taurus OX=9913 GN=JUND PE=2 SV=1
METPFYGDEALSGLGGGGSSSGGGGSFASPGRLFPGAPPTAAPGSMMKKDALTLSLSEQV
AAALKPAAAPPPGPLRTDGAPGTAPPDGLLAS*92PELGLLKLAS*102PELERLIIQSNGLVTTT*119P
TSTQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLSAGAASAAAAAGGPSGTAAGAAPPS
ELAPAAATPEAPVYANLSSYAGGTGSAGGAATVAFAAEPVPFPPPPPPGTLGPPRLAALK
DEPQTVPDVPS*251FGES*255PPLS*259PIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
|
---|
Predicted Disorder Regions | 5 disordered segments; (2-97), (123-192),(202-210), (262-294), (332-339) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | Ryder K, Lanahan A, Perez-Albuerne E, Nathans D. jun-D: a third member of the jun gene family. Proc Natl Acad Sci U S A. 1989 Mar;86(5):1500-3. doi: 10.1073/pnas.86.5.1500. PMID: 2493644; PMCID: PMC286724. |