Search by BoMiProt ID - Bomi9939


Primary Information

BoMiProt ID Bomi9939
Protein Name Transcription factor jun-B
Organism Bos taurus
Uniprot IdQ0VBZ5
Milk FractionWhey
Ref Sequence Id NP_001069124.1
Aminoacid Length 347
Molecular Weight 35929
Fasta Sequence https://www.uniprot.org/uniprot/Q0VBZ5.fasta
Gene Name JUNB
Gene Id 514246
Protein Existence Status Reviewed

Secondary Information

Protein Function Maintain Organ-Specific Treg Proportions.and maintain Treg homeostasis. JunB is a transcriptional activator of various cytokine genes, such as IL-2, IL-4, and IL-10.JunB is another member of the AP-1 family of transcription factor. contain basic leucine zipper (bZIP) domains
Significance in milk Control milk protein genes expression.
PTMs Sumoylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VBZ5|JUNB_BOVIN Transcription factor JunB OS=Bos taurus OX=9913 GN=JUNB PE=2 SV=1 MCTKMEQPFYHDDSYAAAGYGRTPGGLSLHDYKLLKPSLALNLSDPYRNLKAPGARGPGP EGNGGGSYFSSQGSDTGASLKLASSELERLIVPNSNGVITTT*102PT*104PPGQYFYPRGGGS*117GGG AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGASGGPPAGPGGVYAGPEPPP VYTNLSSYSPASAPSGGAGAAVGTGSSYPTATISYLPHAPPFAGGHPAQLGLGRGASAFK EEPQTVPEARS*251RDAT*255PPVS*259PINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
Predicted Disorder Regions 18-26, 46-86, 99-143, 153-192, 218-222, 234-251, 260-268, 279-288
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs JunB sumoylation of JunB regulates its ability to induce cytokine gene transcription and likely plays a critical role in T cell activation.sumoylation is responsible for trans activating IL-2 and IL-4 reporter genes
Bibliography Garaude J, Farrás R, Bossis G, Charni S, Piechaczyk M, Hipskind RA, Villalba M. SUMOylation regulates the transcriptional activity of JunB in T lymphocytes. J Immunol. 2008 May 1;180(9):5983-90. doi: 10.4049/jimmunol.180.9.5983. PMID: 18424718.