Search by BoMiProt ID - Bomi9933


Primary Information

BoMiProt ID Bomi9933
Protein Name Transcription factor Dp-1
Organism Bos taurus
Uniprot IdQ17QZ4
Milk FractionWhey
Ref Sequence Id NP_001069497.1
Aminoacid Length 410
Molecular Weight 44926
Fasta Sequence https://www.uniprot.org/uniprot/Q17QZ4.fasta
Gene Name TFDP1
Gene Id 534579
Protein Existence Status reviewed

Secondary Information

Protein Function regulate the cell cycle during the G1 to S phase transition via transcriptional regulation of target genes.
Biochemical Properties comprises three DP subunits (DP-1 to DP-3) and eight E2F subunits (E2F-1 to E2F-8).The region important for protein stabilization may reside in the C-terminus of DP-1.
PTMs Acetylation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q17QZ4|TFDP1_BOVIN Transcription factor Dp-1 OS=Bos taurus OX=9913 GN=TFDP1 PE=2 SV=1 MAKDAGLIEANGELKVFIDQNLS*23PGKGVVSLVAVHPSTVNSLGKQLLPKTFGQSNVNITQ QVVIGTPQRPAAPNTIVVGSPHTPNTHFVSQNQPSDPSPWSAGKRNRKGEKNGKGLRHFS MKVCEKVQRKGTTSYNEVADELVAEFSAADSHILPSESAYDQKNIRRRVYDALNVLMAMN IISKEKKEIKWIGLPTNSAQECQSLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRN RQVEQQASRPPPPNSVIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVL KRMGMACGLESGSCSPEDLRVARSLVPKALEPYVTEMAQGSLGGVFVASAVSTSNGTRLS ASDLANGADGALATSSSGSQYSGSRVETPVSCVGEDDEDDEDFNENEEED
Predicted Disorder Regions 66-74, 83-124, 241-253, 342-345, 354-410
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Arakawa T, Masuhiro Y, Kamiya Y, Kojima H, Hanazawa S. Identification of significant regions of transcription factor DP-1 (TFDP-1) involved in stability/instability of the protein. Biochem Biophys Res Commun. 2010 Jun 25;397(2):345-9. doi: 10.1016/j.bbrc.2010.05.127. Epub 2010 May 27. PMID: 20513349.