Search by BoMiProt ID - Bomi9924


Primary Information

BoMiProt ID Bomi9924
Protein Name Transcription elongation factor A protein 1/Transcription elongation factor S-II protein 1
Organism Bos taurus
Uniprot IdQ29RL9
Milk FractionWhey
Ref Sequence Id NP_001039390.1
Aminoacid Length 301
Molecular Weight 33891
Fasta Sequence https://www.uniprot.org/uniprot/Q29RL9.fasta
Gene Name TCEA1
Gene Id 505722
Protein Existence Status reviewed

Secondary Information

Protein Function This elongation factors help RNA polymerase II to transcribe past blockages due to specific DNA sequences, DNA-binding proteins, and transcription-arresting drugs.required for balance between proliferation and differentiation.
PTMs Phosphorylation on Ser,Acetylation on Met
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RL9|TCEA1_BOVIN Transcription elongation factor A protein 1 OS=Bos taurus OX=9913 GN=TCEA1 PE=2 SV=1 MEDEVIRIAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQS*57TDE EVTSLAKSLIKSWKKLLDGPS*81TDKDSEEKKKDTAVTS*97QNS*100PEAREESSSSGNMSSRKDET NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEI RNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKF C
Predicted Disorder Regions 8-23, 54-58, 73-139, 155-181, 231-252, 258-263
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Yang T, Cui H, Wen M, Zuber J, Kogan SC, Wei G. TCEA1 regulates the proliferative potential of mouse myeloid cells. Exp Cell Res. 2018 Sep 15;370(2):551-560. doi: 10.1016/j.yexcr.2018.07.020. Epub 2018 Jul 25. PMID: 30009791; PMCID: PMC6816334. 2.Ito T, Doi K, Matsumoto N, Kakihara F, Noiri E, Hasegawa S, Tokunaga K, Sekimizu K. Lack of polymorphisms in the coding region of the highly conserved gene encoding transcription elongationfactor S-II (TCEA1). Drug Discov Ther. 2007 Aug;1(1):9-11. PMID: 22504358.