Search by BoMiProt ID - Bomi9920


Primary Information

BoMiProt ID Bomi9920
Protein Name Transcription activator BRG1/ATP-dependent helicase SMARCA4/BRG1-associated factor 190A/Protein brahma homolog 1/SNF2-beta/SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4
Organism Bos taurus
Uniprot IdA7Z019
Milk FractionWhey
Ref Sequence Id NP_001099084.1
Aminoacid Length 1606
Molecular Weight 180679
Fasta Sequence https://www.uniprot.org/uniprot/A7Z019.fasta
Gene Name SMARCA4/BAF190A/ BRG1/SNF2B/ SNF2L4
Gene Id 414274
Protein Existence Status reviewed

Secondary Information

Protein Function functional role in transcriptional activation and repression of select genes by chromatin remodeling.
Biochemical Properties ATP binding activity.Has domain required for binding to 'Lys-15'-acetylated histone 3.BRG1 bromodomain is important for BAF recruitment to active enhancers.
PTMs Acetylation, Isopeptide bond formation, Phosphoprotein, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus OX=9913 GN=SMARCA4 PE=2 SV=1 MSTPDPALGGT*11PRPGPSPGPGPSPGAMLGPSPGPSPGSAHSIMGPSPGPPSAGHPIPTQG PGGYPQDNMHQMHKPMESMHEKGMSDDPRYTQMKGMGMRSGGHAGMGPPPSPMDQHSQGY PSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQL RAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQPQMPALPPPSVSATGPGPSPGPAPPN YSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPT GRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRIT*345PIQKPRGLDPVEILQ EREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDT ALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKE YHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDK RLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDE T*601S*602QMS*605DLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEE EEEEQPQPAQPPTLPVEEKKKIPDPDS*687DDVS*691EVDARHIIENAKQDVDDEYGVSQALARGL QSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQ TIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQL RSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLL LTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRL HKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKG KGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRI LPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSE YFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVN SVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDET VNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEE EEEKMFGRGSRHRKEVDYSDS*1341LTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGP ST*1382PTTSTRSRDKDDESKKQKKRGRPPAEKLS*1411PNPPNLTKKMKKIVDAVIKYKDSSSGRQL SEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNL EGSLIYEDSIVLQSVFTSVRQKIEKEDDS*1529EGEES*1534EEEEEGEEEGS*1545ESESRSVKVKIKLGR KEKAQDRLKGGRRRPSRGSRAKPVVS*1586DDDS*1590EEEQEEDRSGSGSEED
Predicted Disorder Regions 653-683, 1531-1545, 1577-1602
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Neuronal activities induce BRG1 phosphorylation at S1382, which depends on CAMKII.BRG1 phosphorylation regulates BAF interactions with transcription co-factors.
Bibliography Kim B, Luo Y, Zhan X, Zhang Z, Shi X, Yi J, Xuan Z, Wu J. Neuronal activity-induced BRG1 phosphorylation regulates enhancer activation. Cell Rep. 2021 Jul 13;36(2):109357. doi: 10.1016/j.celrep.2021.109357. PMID: 34260936; PMCID: PMC8315893.