Search by BoMiProt ID - Bomi9893


Primary Information

BoMiProt ID Bomi9893
Protein Name Tonsoku-like protein/Inhibitor of kappa B-related protein/I-kappa-B-related protein/IkappaBR/NF-kappa-B inhibitor-like protein 2/Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 2
Organism Bos taurus
Uniprot IdQ0P5G1
Milk FractionWhey
Ref Sequence Id NP_001068656.1
Aminoacid Length 1374
Molecular Weight 150245
Fasta Sequence https://www.uniprot.org/uniprot/Q0P5G1.fasta
Gene Name TONSL/IKBR/ NFKBIL2
Gene Id 505102
Protein Existence Status reviewed

Secondary Information

Protein Function function as regulators of the NF-kappaB family of transcription factors. 
Biochemical Properties Most members of the NF-kB family can form homo- or heterodimers (except for RelB, which only forms heterodimers with p50 or p52) that bind slightly different kB motifs.
PTMs Methylation,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0P5G1|TONSL_BOVIN Tonsoku-like protein OS=Bos taurus OX=9913 GN=TONSL PE=2 SV=1 MSLERELRQLSKAKTKAQRSGQLREEASVCHQLGELLASHGCYAEALREHQQELQLLETT DDPLGCAVAHRKIGERLAEMEDYSAALQHQHRYLELACALSNHVEQQRAWATIGRTHLDI YDHHQSQDALQQAQDAFEKSLAILDEKLQGSLPKRELSEMRTRIYLNLGLTCESLQQVAL CSAYFKKSIFLAEQNHLYEDLFRARYNLGAIHWRRGQHSQAMRCLEGARECARVLKQAFL ESECCLLLSQVLLDLGDFLAAKRALKKAYRLGSQKPLQKASVCRTLKYVLAVVQLQQRLE ESEESDPEVAMGICEQLGDLFSKAGDFPKAAAAYQKQLRFAELLSRPGPELAVIHVSLAA TLGDMKDHRQAVHHYEAELKLQEGNPLEEAKTWLNIALSREEAGDAYEVLALCFQKALGC AQLAGQPQLQRQILQHLHAVQLRLQPQEAPSTETRLQELKAAGDEDEGDGEDEEDEEDDD ALEATELELSESENEADASPPLEEDEELRGCLGRQRVNKWSRRNDVGETLLHRACIEGQL GRVQDLVRQGHPLNPRDYCGWTPLHEACNYGHLDIVRFLLDHGAAVDDPGGQGCDGITPL HDALNCGHFEVAELLIERGASVTLRTRKGHNPLETLQQWVKLYGKDLDSETQEKAAAMGR LLQAASLGRAPHSSQAPQTLPSNHLFDPETSPPSSPCPGTPEVCEASTRVS*711QGLAVSTVA RPRRSRHKVASSSSSEGEDSAGPSQPTQKRPRHASPSLQTKAPMPGPASDREAATTSTSW AAYREAIRGVGSAQTCRLGPSPLRGPSEIPIPQAALIPQEECLAGDWLEEDFPMSPGHRG RCPARPQSSGDGGRHRASGPGSDTARRPRAQARQSRLPYLESWSTPVRADRANSQATEPA RSPDVPRVVAPTGENPTTGHLPGQVLPPPIRVRVRVQDNLFLIPVPHREAHSVAWLAEQA AQRHYQASGLLPRLSLQKEGALLAPQDPIPDVLQSNEEVLAEVTSWDLPPLRDRYRRACQ TLEQGEHQQVLQAVEHQGSAPTFSACSLALRQAQLTPLLRALKLHSALRELRLAGNRLGD GCVAELLATLDTVPGLTLLDLSSNHLGPEGLRQLAAGLLGQTTLQNLEELDLSMNPLGDG CGQALASILRACPVLCTLHLQACGFGPGFFLSHQVALGSAFQDTKCLKTLSLSYNGLGPT ALGPVLGSLPAHSLLRLELSSVVTGKSDVGLTDPVVHYLSQEGCVLEHLSLSANHLGDKD VRALSRCLPLCPSLVSLDLSANPEVSSAGLEELLSTLQKRPQGLSFLGLSGCAVQGPLGL DLWDKVVAQLQELQLCTRRLSAEDRNALHQLLPSQLGPKVCTLDQGPKLFFRHL
Predicted Disorder Regions 438-504, 678-689, 736-739, 882-888
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments IkappaBR can aid activation of select NF-kappaB-regulated genes by sequestering p50 homodimers.
Bibliography 1.Ray P, Yang L, Zhang DH, Ghosh SK, Ray A. Selective up-regulation of cytokine-induced RANTES gene expression in lung epithelial cells by overexpression of IkappaBR. J Biol Chem. 1997 Aug 8;272(32):20191-7. doi: 10.1074/jbc.272.32.20191. PMID: 9242696.