Search by BoMiProt ID - Bomi9824


Primary Information

BoMiProt ID Bomi9824
Protein Name Thymidylate synthase/TS/Tsase
Organism Bos taurus
Uniprot IdQ2TA32
Milk FractionWhey
Ref Sequence Id NP_001032905.1
Aminoacid Length 354
Molecular Weight 39785
Fasta Sequence https://www.uniprot.org/uniprot/Q2TA32.fasta
Gene Name TYMS/TS
Gene Id 507631
Protein Existence Status reviewed

Secondary Information

Protein Function Contributes to the de novo mitochondrial thymidylate biosynthesis pathway.
PTMs Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2TA32|TYSY_BOVIN Thymidylate synthase OS=Bos taurus OX=9913 GN=TYMS PE=2 SV=1 MPAAGSEPSRPPSPPGVQEQSAEPRPPPPPHGELQYLGQIEHILRCGFRRDDRTGTGTLS VFGMQARYNLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGS*117RDF LDGLGFSDRAEGDLGPVYGFQWRHFGAEYKDMDSEYSGQGVDQLQKVIDTIKTNPNDRRI ILCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIASYALLTYMI AHITDLKPGDFVHTLGDAHIYLNHIEPLKTQALMELRGQSSRSLDGDGQAGTSRWAPVAT DTERDRCCELQREPRPFPKLKILRKVETIDDFQAEDFQIEGYNPNPTIKMEMAV
Predicted Disorder Regions 1-34, 150-154, 278-309
DisProt Annotation
TM Helix Prediction no TM helices
Bibliography Brouillette, J. A., Andrew, J. R., & Venta, P. J. (2000). Estimate of nucleotide diversity in dogs with a pool-and-sequence method. Mammalian genome : official journal of the International Mammalian Genome Society, 11(12), 1079–1086. https://doi.org/10.1007/s003350010220