Search by BoMiProt ID - Bomi9820


Primary Information

BoMiProt ID Bomi9820
Protein Name Thrombospondin-4
Organism Bos taurus
Uniprot IdQ3SWW8
Milk FractionWhey
Ref Sequence Id NP_001029900.1
Aminoacid Length 961
Molecular Weight 105974
Fasta Sequence https://www.uniprot.org/uniprot/Q3SWW8.fasta
Gene Name THBS4
Gene Id 541281
Protein Existence Status reviewed

Secondary Information

Protein Function role in ECM remodeling and formation of “transitional matrix”.also participates in wound healing and scar formation.regulates the production and assembly of collagen and organization, repair, and remodeling of ECM.enhances vesicular trafficking of dystrophin-glycoprotein and integrin attachment complexes to stabilize the sarcolemma.Enhances vesicular trafficking of dystrophin-glycoprotein and integrin attachment complexes to stabilize the sarcolemma.Required for angiogenesis by TGF beta pathway.
Biochemical Properties The oligimerization of the subunits to form the TSP-4 pentamer.four EGF-like repeats,also contains type 3 ca+2 binding domain,coiled coil domain which is responsible for pentamerization.
Significance in milk Bone formation
PTMs Disulfide bond formation,Glycosylation,ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SWW8|TSP4_BOVIN Thrombospondin-4 OS=Bos taurus OX=9913 GN=THBS4 PE=2 SV=1 MLAPRGATFLLLHLALQPWLGAGAQATPQVFDLLPSASQRLNPSVLQPILTDPTLNELYV ISTFKLQSKSSATIFGLYSSADHSKYFEFTVMGRLNKAILRYLKNDGRIHLVVFNNLQLA DGRRHRLLLRLTNLHRGAGSVELFLDCTRVDSIHNLPRAFSGLAQSPEAVELRTFQRKAH DSLEELKLVVRGSLIQVASLQDCFLQQSEPLATTNTGDFNRQFLGQMSQLNQLLGEVKDL LRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLMPVVPAASPTPPVRRCDSNPCFRGVR CTDTRDGFQCGPCPEGYTGNGIVCSDVDECRYHPCYPGVRCVNLAPGFRCDACPVGFTGP MMQGVGISFAKTNKQVCTDIDECRNGACVLNSICINTLGSYRCGPCKPGYIGDQMRGCKM ERNCRDPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSAR NCKKDNCKYVPNSGQEDADRDGIGDACDDDADGDGILNEQDNCVLTHNVDQRNSDKDIFG DACDNCRNVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCQKVPNSDQEDRDGDGVGD ACDSCPEVSNPN*612QSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICEADFDQDQVIDRIDVCP ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCN*941DTIPEDFQEFQTQNFDRLD K
Predicted Disorder Regions 558-711
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs poly ubl conjugation on Lys 216 for proteosomal degradation.
Bibliography Stenina-Adognravi O, Plow EF. Thrombospondin-4 in tissue remodeling. Matrix Biol. 2019 Jan;75-76:300-313. doi: 10.1016/j.matbio.2017.11.006. Epub 2017 Nov 11. PMID: 29138119; PMCID: PMC6005712.