Search by BoMiProt ID - Bomi9819


Primary Information

BoMiProt ID Bomi9819
Protein Name Thrombospondin-2/Corticotropin-induced secreted protein
Organism Bos taurus
Uniprot IdQ95116
Milk FractionWhey
Ref Sequence Id NP_789861.1
Aminoacid Length 1170
Molecular Weight 129863
Fasta Sequence https://www.uniprot.org/uniprot/Q95116.fasta
Gene Name THBS2/TSP-2/TSP2
Gene Id 338092
Protein Existence Status reviewed

Secondary Information

Protein Function Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions.modulates collagen fibrillogenesis and angiogenesis
PTMs Disulfide bond, Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q95116|TSP2_BOVIN Thrombospondin-2 OS=Bos taurus OX=9913 GN=THBS2 PE=2 SV=2 MLWPLLLLALWAWPSAQAGDQDEDTAFDLFSISNINRKTIGAKQFRGPDPSVPAYRFVRF DYIPPVSAEHLGRITEAMRRKEGFFLTASMKQDRRSRGTLLALEGPGATHRQFEIVSNGP ADTLDLTYWVDGTQHVISLEDVGLADSQWKN*151VTVQVTGETYSLYVGCDLMDSFALDEPFY EHLQTERSRMYVTKGAARESHFRGLLQNVYLVFENSVEDLLSKKGCQQSQGAETNAISEN TETLHLSPMVTMEHVGPSAEKSPEVCEHSCEELGSMIRELSGLHVIVNQLHENLRKVSND NQFLWELIGGPPKTRN*316VSACWQDGRFFAEN*330ETWVVDSCTKCTCKKFKTVCHQISCPPATC ADPWFVEGECCPSCVHDGEEGWSPWAEWTECSATCGSGTQQRGRSCDVTSNTCLGPSIQT RACSLGRCDHRIRQDGGWSHWSPWSSCSVTCGVGN*455VTRIRLCNSPVPQMGGRSCKGSGRE TKACQGPPCPVDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCVGGAKEQQM CNRKSCPIDGCLSNPCFPGAECSSFPDGSWSCGSCPGGFLGN*582GTHCEDLDECAVVTDVCF ATSKAHRCVNTNPGYHCLPCPPRYKGNQPFGVGLEAARTEKQVCEPENPCKDKTHSCHRH AECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNKNLVCATN*708ATYHCVKDNCPL LPNSGQEDFDKDGIGDACDDDDDNDGVSDEKDNCQLLFNPRQFDYDKDEVGDRCDNCPYV HNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVH NPDQTDVDNDLVGDQCDNNEDIDEDGHQNNQDNCPHIPNANQADHDRDGQGDACDSDDDN DGIPDDRDNCRLVANPDQEDSDGDRRGDACKDDFDN*936DSIPDIDDVCPENNAISETDFRNF QMVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDD DYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVN*1067STTGTGEHLRNAL WHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYD QTYAGGRLGLFVFSQEMVYFSDLKYECRDV
Predicted Disorder Regions 766-974
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Bornstein P, Kyriakides TR, Yang Z, Armstrong LC, Birk DE. Thrombospondin 2 modulates collagen fibrillogenesis and angiogenesis. J Investig Dermatol Symp Proc. 2000 Dec;5(1):61-6. doi: 10.1046/j.1087-0024.2000.00005.x. PMID: 11147677. 2.Lawler J. The functions of thrombospondin-1 and-2. Curr Opin Cell Biol. 2000 Oct;12(5):634-40. doi: 10.1016/s0955-0674(00)00143-5. PMID: 10978901.