Search by BoMiProt ID - Bomi9816


Primary Information

BoMiProt ID Bomi9816
Protein Name Three prime repair exonuclease 1 isoform b
Organism Bos taurus
Uniprot IdQ9BG99
Milk FractionWhey
Aminoacid Length 315
Molecular Weight 33132
Fasta Sequence https://www.uniprot.org/uniprot/Q9BG99.fasta
Gene Name TREX1
Gene Id 282099
Protein Existence Status reviewed

Secondary Information

Protein Function most abundant 3'→5' exonuclease in mammalian cells. digests single-stranded DNA (ssDNA).It has been suggested that TREX1 degrades HIV-1 DNA to enable the virus to evade the innate immune system.Trex1 is an upstream regulator of radiation-driven anti-tumour immunity.They can transport L-lactate and pyruvate across the plasma membrane.
Biochemical Properties 304 aa long. three conserved motifs that likely generate the exonuclease active site in these enzymes.
PTMs Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9BG99|TREX1_BOVIN Three-prime repair exonuclease 1 OS=Bos taurus OX=9913 GN=TREX1 PE=1 SV=1 MGSRALPPGPVQTLIFLDLEATGLPFSQPKITELCLLAVHRYALEGLSAPQGPSPTAPVP PRVLDKLSLCVAPGKVCS*78PAASEITGLSTAVLAAHGRRAFDADLVNLIRTFLQRQPQPWC LVAHNGDRYDFPLLRAELALLGLASALDDAFCVDSIAALKALEPTGS*167SSEHGPRKSYSLG SVYTRLYGQAPPDSHTAEGDVLALLSVCQWRPRALLRWVDAHAKPFSTVKPMYVITTSTG TNPRPSAVTATVPLARASDTGPNLRGDRSPKPAPSPKMCPGAPPGEGLLAPLGLLAFLTL AVAMLYGLSLAMPGQ
Predicted Disorder Regions 4 disordered segments; (1-7), (48-60), (166-174), (243-284)
DisProt Annotation
TM Helix Prediction 1TMH ;(288-310)
Bibliography Mazur DJ, Perrino FW. Identification and expression of the TREX1 and TREX2 cDNA sequences encoding mammalian 3'-->5' exonucleases. J Biol Chem. 1999 Jul 9;274(28):19655-60. doi: 10.1074/jbc.274.28.19655. PMID: 10391904.