Search by BoMiProt ID - Bomi9815


Primary Information

BoMiProt ID Bomi9815
Protein Name THO complex subunit 4/Ally of AML-1 and LEF-1/ Aly/REF export factor/Transcriptional coactivator Aly/REF/bZIP-enhancing factor BEF
Organism Bos taurus
Uniprot IdQ3T0I4
Milk FractionWhey
Ref Sequence Id NP_001030494.1
Aminoacid Length 257
Molecular Weight 26953
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0I4.fasta
Gene Name ALYREF/ALY/BEF/THOC4
Gene Id 537706
Protein Existence Status reviewed

Secondary Information

Protein Function Aly/REF export factor (ALYREF) plays key roles in RNA metabolism, and is involved in RNA nuclear export, RNA stability, and gene transcription.
Biochemical Properties Specifically, ALYREF couples with RNA helicase UAP56 and the THO sub-complex to form the TREX complex that regulates the nuclear export of mRNAs.
PTMs N6-Acetylation at Lys , Citrullination, Arg-50 and Arg-204 are dimethylated, probably to asymmetric dimethylarginine, Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0I4|THOC4_BOVIN THO complex subunit 4 OS=Bos taurus OX=9913 GN=ALYREF PE=2 SV=1 MADKMDMS*8LDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPA IARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDS*94GFGGGAGVETGGKLLVSNLDFGVSDA DIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQL VTSQIDTQRRPAQSVNRGGMTRNRGSGGFGGGGGTRRGTRGGSRGRGRGTGRSSKQQLS*239A EELDAQLDAYNARMDTS
Predicted Disorder Regions 1-100, 182-257
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Arg-50 and 204 are dimethylated, leading to asymmetric dimethylarginine.
Additional Comments high ALYREF expression in GBM tissues was enriched in the upregulation of oncogenic pathways such as the Wnt/β-catenin signaling pathway. 
Bibliography 1.Wang J, Li Y, Xu B, Dong J, Zhao H, Zhao D, Wu Y. ALYREF Drives Cancer Cell Proliferation Through an ALYREF-MYC Positive Feedback Loop in Glioblastoma. Onco Targets Ther. 2021 Jan 8;14:145-155. doi: 10.2147/OTT.S286408. PMID: 33447056; PMCID: PMC7802773. 2.Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA.Chi B, Wang Q, Wu G, Tan M, Wang L, Shi M, Chang X, Cheng H Nucleic Acids Res. 2013 Jan; 41(2):1294-306. 3.ALYREF links 3'-end processing to nuclear export of non-polyadenylated mRNAs.Fan J, Wang K, Du X, Wang J, Chen S, Wang Y, Shi M, Zhang L, Wu X, Zheng D, Wang C, Wang L, Tian B, Li G, Zhou Y, Cheng HEMBO J. 2019 May 2; 38(9):. 4.