Primary Information |
---|
BoMiProt ID | Bomi9815 |
---|
Protein Name | THO complex subunit 4/Ally of AML-1 and LEF-1/ Aly/REF export factor/Transcriptional coactivator Aly/REF/bZIP-enhancing factor BEF |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q3T0I4 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001030494.1 |
---|
Aminoacid Length | 257 |
---|
Molecular Weight | 26953 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q3T0I4.fasta |
---|
Gene Name | ALYREF/ALY/BEF/THOC4 |
---|
Gene Id | 537706 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Aly/REF export factor (ALYREF) plays key roles in RNA metabolism, and is involved in RNA nuclear export, RNA stability, and gene transcription. |
---|
Biochemical Properties | Specifically, ALYREF couples with RNA helicase UAP56 and the THO sub-complex to form the TREX complex that regulates the nuclear export of mRNAs. |
---|
PTMs | N6-Acetylation at Lys , Citrullination, Arg-50 and Arg-204 are dimethylated, probably to asymmetric dimethylarginine, Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0I4|THOC4_BOVIN THO complex subunit 4 OS=Bos taurus OX=9913 GN=ALYREF PE=2 SV=1
MADKMDMS*8LDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPA
IARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDS*94GFGGGAGVETGGKLLVSNLDFGVSDA
DIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQL
VTSQIDTQRRPAQSVNRGGMTRNRGSGGFGGGGGTRRGTRGGSRGRGRGTGRSSKQQLS*239A
EELDAQLDAYNARMDTS
|
---|
Predicted Disorder Regions | 1-100, 182-257 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Arg-50 and 204 are dimethylated, leading to asymmetric dimethylarginine. |
---|
Additional Comments | high ALYREF expression in GBM tissues was enriched in the upregulation of oncogenic pathways such as the Wnt/β-catenin signaling pathway. |
---|
Bibliography | 1.Wang J, Li Y, Xu B, Dong J, Zhao H, Zhao D, Wu Y. ALYREF Drives Cancer Cell Proliferation Through an ALYREF-MYC Positive Feedback Loop in Glioblastoma. Onco Targets Ther. 2021 Jan 8;14:145-155. doi: 10.2147/OTT.S286408. PMID: 33447056; PMCID: PMC7802773. 2.Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA.Chi B, Wang Q, Wu G, Tan M, Wang L, Shi M, Chang X, Cheng H Nucleic Acids Res. 2013 Jan; 41(2):1294-306. 3.ALYREF links 3'-end processing to nuclear export of non-polyadenylated mRNAs.Fan J, Wang K, Du X, Wang J, Chen S, Wang Y, Shi M, Zhang L, Wu X, Zheng D, Wang C, Wang L, Tian B, Li G, Zhou Y, Cheng HEMBO J. 2019 May 2; 38(9):. 4. |