Primary Information |
|---|
| BoMiProt ID | Bomi9788 |
|---|
| Protein Name | Tetratricopeptide repeat protein 4 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q5EA11 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001015554.1 |
|---|
| Aminoacid Length | 388 |
|---|
| Molecular Weight | 44373 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TTC4/TPR repeat protein 4 |
|---|
| Gene ID | 509047 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | mediate protein-protein interactions and chaperone activity and act as a TBK1 Interactor and a Positive Regulator of SeV-Induced Innate Immunity. |
|---|
| Biochemical Properties | which form scaffolds to mediate protein-protein interactions and often the assembly of multiprotein complexes. TPR-containing proteins include the anaphase promoting complex (APC) subunits cdc16, cdc23 and cdc27, the NADPH oxidase subunit p67 phox, hsp90-binding immunophilins, transcription factors, the PKR protein kinase inhibitor, and peroxisomal and mitochondrial import proteins |
|---|
| PTMs | N-acetylation at Meth |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5EA11|TTC4_BOVIN Tetratricopeptide repeat protein 4 OS=Bos taurus OX=9913 GN=TTC4 PE=2 SV=2
MEQQEPGATLDDGMDSFLEKFQSQPYRGGFHESQWEEEFEKIPLFMKNSPS*51EIDPLENPD
LACLQSIIFDEERSPEDQARTYKDEGNDYFKEKDYKKAVISYTEGLKKKCADPDLNAVLY
TNRAAAQYYLGNFRSSLNDVTAARKLKPCHLKAIIRGASCHLELKNYVEAVNWCDEGLQI
DATEKKLLDLRAKADKLKRTEQRDVRKAKLKEKKQQDQNEALLQAIKARNIRLVAEAAGE
DEDS*244ASEGLSELVLYGLSSENPCGARLGVDDQGRLSWPVLFLYPEYAQSDLVSAFHEDSR
FIDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYCVPPSSTLLQVLQHPRYFVKA
LTPTFLVCVGSSGFCRNYLRGKKVHQVK
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Promoting TTC4 and HSP70 interaction and translocation of annexin A7 to lysosome inhibits apoptosis in vascular endothelial cells |
|---|
| Bibliography | 1.Das, A K et al. “The structure of the tetratricopeptide repeats of protein phosphatase 5: implications for TPR-mediated protein-protein interactions.” The EMBO journal vol. 17,5 (1998): 1192-9. doi:10.1093/emboj/17.5.1192. 2.Shang J, Xia T, Han QQ, Zhao X, Hu MM, Shu HB, Guo L. Quantitative Proteomics Identified TTC4 as a TBK1 Interactor and a Positive Regulator of SeV-Induced Innate Immunity. Proteomics. 2018 Jan;18(2). doi: 10.1002/pmic.201700403. PMID: 29251827. 3.He X, Lin Z, Ning J, Li N, Cui X, Zhao B, Hong F, Miao J. Promoting TTC4 and HSP70 interaction and translocation of annexin A7 to lysosome inhibits apoptosis in vascular endothelial cells. FASEB J. 2020 Sep;34(9):12932-12945. doi: 10.1096/fj.202000067R. Epub 2020 Aug 9. PMID: 33000523. |