Search by BoMiProt ID - Bomi9788


Primary Information

BoMiProt ID Bomi9788
Protein Name Tetratricopeptide repeat protein 4
Organism Bos taurus
Uniprot IdQ5EA11
Milk FractionWhey
Ref Sequence Id NP_001015554.1
Aminoacid Length 388
Molecular Weight 44373
Fasta Sequence https://www.uniprot.org/uniprot/Q5EA11.fasta
Gene Name TTC4/TPR repeat protein 4
Gene Id 509047
Protein Existence Status reviewed

Secondary Information

Protein Function mediate protein-protein interactions and chaperone activity and act as a TBK1 Interactor and a Positive Regulator of SeV-Induced Innate Immunity.
Biochemical Properties which form scaffolds to mediate protein-protein interactions and often the assembly of multiprotein complexes. TPR-containing proteins include the anaphase promoting complex (APC) subunits cdc16, cdc23 and cdc27, the NADPH oxidase subunit p67 phox, hsp90-binding immunophilins, transcription factors, the PKR protein kinase inhibitor, and peroxisomal and mitochondrial import proteins
PTMs N-acetylation at Meth
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5EA11|TTC4_BOVIN Tetratricopeptide repeat protein 4 OS=Bos taurus OX=9913 GN=TTC4 PE=2 SV=2 MEQQEPGATLDDGMDSFLEKFQSQPYRGGFHESQWEEEFEKIPLFMKNSPS*51EIDPLENPD LACLQSIIFDEERSPEDQARTYKDEGNDYFKEKDYKKAVISYTEGLKKKCADPDLNAVLY TNRAAAQYYLGNFRSSLNDVTAARKLKPCHLKAIIRGASCHLELKNYVEAVNWCDEGLQI DATEKKLLDLRAKADKLKRTEQRDVRKAKLKEKKQQDQNEALLQAIKARNIRLVAEAAGE DEDS*244ASEGLSELVLYGLSSENPCGARLGVDDQGRLSWPVLFLYPEYAQSDLVSAFHEDSR FIDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYCVPPSSTLLQVLQHPRYFVKA LTPTFLVCVGSSGFCRNYLRGKKVHQVK
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Promoting TTC4 and HSP70 interaction and translocation of annexin A7 to lysosome inhibits apoptosis in vascular endothelial cells
Bibliography 1.Das, A K et al. “The structure of the tetratricopeptide repeats of protein phosphatase 5: implications for TPR-mediated protein-protein interactions.” The EMBO journal vol. 17,5 (1998): 1192-9. doi:10.1093/emboj/17.5.1192. 2.Shang J, Xia T, Han QQ, Zhao X, Hu MM, Shu HB, Guo L. Quantitative Proteomics Identified TTC4 as a TBK1 Interactor and a Positive Regulator of SeV-Induced Innate Immunity. Proteomics. 2018 Jan;18(2). doi: 10.1002/pmic.201700403. PMID: 29251827. 3.He X, Lin Z, Ning J, Li N, Cui X, Zhao B, Hong F, Miao J. Promoting TTC4 and HSP70 interaction and translocation of annexin A7 to lysosome inhibits apoptosis in vascular endothelial cells. FASEB J. 2020 Sep;34(9):12932-12945. doi: 10.1096/fj.202000067R. Epub 2020 Aug 9. PMID: 33000523.