Search by BoMiProt ID - Bomi9780


Primary Information

BoMiProt ID Bomi9780
Protein Name Tetraspanin-6/TSPAN6
Organism Bos taurus
Uniprot IdQ32KU6
Milk FractionWhey
Ref Sequence Id NP_001033198.1
Aminoacid Length 245
Molecular Weight 27524
Fasta Sequence https://www.uniprot.org/uniprot/Q32KU6.fasta
Gene Name TSPAN6
Gene Id 514741
Protein Existence Status reviewed

Secondary Information

Protein Function negative regulator of exosome release due to lysosomal degradation of SDC4(syndecan) and syntenin.
Significance in milk Embryo Development and Implantation
PTMs glycosylation and palmitoylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32KU6|TSN6_BOVIN Tetraspanin-6 OS=Bos taurus OX=9913 GN=TSPAN6 PE=2 SV=1 MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIGTGTVIILLGTFGCFATCRASAWMLKLYAMFLTLIFLVELVAAIIGFVFRHEIKN SLKNNYEKALKQYN*134ATGDYRSDAVDKIQSMLHCCGVTNYRDWKDTNYYSEKGFPESCCKL EDCSPQRDADKVNNEGCFIMVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV
Predicted Disorder Regions (1-8)
DisProt Annotation
TM Helix Prediction 4TMHs; (20-42),( 57-79), (92-114), (211-233)
Significance of PTMs Tetraspanins are usually post-translationally modified by glycosylation in extracellular domains and palmitoylation at intracellular cysteines. They also contain a tyrosine-based sorting motif for intracellular compartment targeting that may mediate internalization via associated proteins.
Bibliography Jankovičová J, Sečová P, Michalková K, Antalíková J. Tetraspanins, More than Markers of Extracellular Vesicles in Reproduction. Int J Mol Sci. 2020 Oct 14;21(20):7568. doi: 10.3390/ijms21207568. PMID: 33066349; PMCID: PMC7589920.