Primary Information |
|---|
| BoMiProt ID | Bomi9780 |
|---|
| Protein Name | Tetraspanin-6/TSPAN6 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q32KU6 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001033198.1 |
|---|
| Aminoacid Length | 245 |
|---|
| Molecular Weight | 27524 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TSPAN6 |
|---|
| Gene ID | 514741 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | negative regulator of exosome release due to lysosomal degradation of SDC4(syndecan) and syntenin. |
|---|
| Significance in milk | Embryo Development and Implantation |
|---|
| PTMs | glycosylation and palmitoylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q32KU6|TSN6_BOVIN Tetraspanin-6 OS=Bos taurus OX=9913 GN=TSPAN6 PE=2 SV=1
MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV
PFVLIGTGTVIILLGTFGCFATCRASAWMLKLYAMFLTLIFLVELVAAIIGFVFRHEIKN
SLKNNYEKALKQYN*134ATGDYRSDAVDKIQSMLHCCGVTNYRDWKDTNYYSEKGFPESCCKL
EDCSPQRDADKVNNEGCFIMVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN
QYEIV
|
|---|
| Predicted Disorder Regions | (1-8) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 4TMHs; (20-42),( 57-79), (92-114), (211-233) |
|---|
| Significance of PTMs | Tetraspanins are usually post-translationally modified by glycosylation in extracellular domains and palmitoylation at intracellular cysteines. They also contain a tyrosine-based sorting motif for intracellular compartment targeting that may mediate internalization via associated proteins. |
|---|
| Bibliography | Jankovičová J, Sečová P, Michalková K, Antalíková J. Tetraspanins, More than Markers of Extracellular Vesicles in Reproduction. Int J Mol Sci. 2020 Oct 14;21(20):7568. doi: 10.3390/ijms21207568. PMID: 33066349; PMCID: PMC7589920. |
|---|
