Search by BoMiProt ID - Bomi9764


Primary Information

BoMiProt ID Bomi9764
Protein Name Tensin-4
Organism Bos taurus
Uniprot IdQ32PJ7
Milk FractionWhey,MFGM
Ref Sequence Id NP_001033244.1
Aminoacid Length 716
Molecular Weight 75888
Fasta Sequence https://www.uniprot.org/uniprot/Q32PJ7.fasta
Gene Name TNS4
Gene Id 532898
Protein Existence Status reviewed

Secondary Information

Protein Function May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton May promote apoptosis, via its cleavage by caspase-3. Cytoplasm, cytoskeleton.
Biochemical Properties The SH2 domain of tensin binds to focal adhesions.Tensin shares homology is an amino acid sequence with actin.The homologous regions of tensin and synapsin are highly positively charged (pb1 l), and it is conceivable that a target for both is a negatively charged moiety, such as the negatively charged surface of synaptic vesicles or the phospholipids associated with focal adhesions; this would be further evidence for a role for tensin in membrane interactions. residues 223 to 25 1) which is a potential tropomyosin-binding site.
PTMs phosphorylated on serine and threonine residues
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32PJ7|TENS4_BOVIN Tensin-4 OS=Bos taurus OX=9913 GN=TNS4 PE=2 SV=2 MSQVMSSPLLAGGPAVGLAPCEEPRRVLHPAPSPSLPPPCPYYTTEGWGAQALMAPMPCK GPPVRLQPAPQAGANASCLLKAPGEQVSGAQEDLDSYIDFSLESLNQMILELDPTFQLLP PGPGGPEAQPTQSTTLGKKKEEPEALDIKYIEVTSTRSRCHDGPRSCCSPSVTPPFGSPR TGGLLLSRDLPRETRSSSESLIFSGSQGRGHQHPAPPSAVPSSHPPTSPSISIPGMGSKA SGPHGLGS*248PLVASPSLEKGLGGQGPQLSSRVSMLSGSPASDISYVFGSSQSLLHSSISSH QSSSRSLESPSSSSSSLNNLGPVSLYTRASDLQVPSNATPSMGQPRATRSPPLAKEHASS CPPSITNSMTDIPIVLINGFPEPGSPPSQRTPGPQDFVRPGATSSSMPCPATRSHSQTLP EAPPTASPEGPARDMQPTMKFVMDTSKYWFKPSISREQAIELLRKEEPGAFIVRDSSSYR GSFGLALKVQEAPTPAQSRPGEDSSDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQ HSIMALALPCKLVIPQKELGGGDGASDPSADGQASCLKKSAGCHALYLSSVSVETLSGAL AVEKAISATLERDVLPTPTVVHFKVTEQGITLTDVQRKVFFRRHYPLATLRFCGMDPEQR KWQKYCKPSRIFGFVAKSQTESQENVCHLFAEYDTLQPASQVIRLVGALLQDPERM
Predicted Disorder Regions 9 disordered segments; (2-7), (42-47), (67-134), (156-175), (216-256), (274-337), (353-368), (398-407), (561-581)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs under certain conditions it becomes highly tyrosine-phosphorylated.Tensin might also participate in serine threonine kinase mediated signal transduction.
Additional Comments Tensin prevents and suppresses cellular transformation
Bibliography Lo SH, Weisberg E, Chen LB. Tensin: a potential link between the cytoskeleton and signal transduction. Bioessays. 1994 Nov;16(11):817-23. doi: 10.1002/bies.950161108. PMID: 7840759.