Search by BoMiProt ID - Bomi9678


Primary Information

BoMiProt ID Bomi9678
Protein Name Syntaxin-17
Organism Bos taurus
Uniprot IdQ5E9Y2
Milk FractionWhey
Ref Sequence Id NP_001029778.1
Aminoacid Length 302
Molecular Weight 33559
Fasta Sequence https://www.uniprot.org/uniprot/Q5E9Y2.fasta
Gene Name STX17
Gene Id 534304
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells localized to the nucleus in normal pancreatic ductal epithelial, acinar, and islet cells
Protein Function autophagosomal SNARE protein that mediates autophagosome maturation,also autophagosome-lysosome fusion
PTMs phosphorylation on Ser and Tyr.Acetylation on Lys
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5E9Y2|STX17_BOVIN Syntaxin-17 OS=Bos taurus OX=9913 GN=STX17 PE=2 SV=1 MSEDEEKVKLRRLEPAIQKFTKIVIPTDLERLRKHQINIEKYQRCRVWDKLHEEHINAGR TVQQLRSNIREMEKLCLKVRKDDLGLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQF NDEETFLQPSLTRSMTVGGTFHSTEDEADPQSMTQIY*157ALPEIPRDQNAAESWETLEADLI ELSQLVTDFSLLVNSQQEKIDSIEDHVNTAAVNVEEGTKNLGKAAKYKLAALPVAGALIG GVVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRRKQKMMEKLASS*289CPDLPSQTDKK CS
Predicted Disorder Regions 136-157, 277-302
DisProt Annotation
TM Helix Prediction 2TMHs ; (229-251) , (257-275)
Significance of PTMs histone acetyltransferase CREBBP/CBP and the deacetylase HDAC2 specifically regulate the acetylation of STX17.deacetylated at K219 and K223 during autophagy.phosphorylation of SNAP25 at S187 site, which is also facing the outside of the alpha-helical bundle of the STX1A-SNAP25-VAMP2/Synaptobrevin 2 SNARE complex, increases the binding of SNAP25 to STX1A and promotes the SNARE complex formation deacetylation of STX17 is required for STX17 to assemble the STX17-SNAP29-VAMP8 SNARE complex and to recruit the HOPS complex, both essential for autophagosome-lysosome fusion.
Bibliography Shen Q, Shi Y, Liu J, Su H, Huang J, Zhang Y, Peng C, Zhou T, Sun Q, Wan W, Liu W. Acetylation of STX17 (syntaxin 17) controls autophagosome maturation. Autophagy. 2021 May;17(5):1157-1169. doi: 10.1080/15548627.2020.1752471. Epub 2020 Apr 15. PMID: 32264736; PMCID: PMC8143222.