Search by BoMiProt ID - Bomi9630


Primary Information

BoMiProt ID Bomi9630
Protein Name Synaptogyrin-2/Cellugyrin
Organism Bos taurus
Uniprot IdA7E3W5
Milk FractionExosomes
Ref Sequence Id NP_001093828.1
Aminoacid Length 224
Molecular Weight 25139
Fasta Sequence https://www.uniprot.org/uniprot/A7E3W5.fasta
Gene Name SYNGR2
Gene Id 513812
Protein Existence Status reviewed

Secondary Information

Protein Function May play a role in regulated exocytosis. In neuronal cells, modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in the formation and/or the maturation of this vesicles. May also play a role in GLUT4 storage and transport to the plasma membrane.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7E3W5|SNG2_BOVIN Synaptogyrin-2 OS=Bos taurus OX=9913 GN=SYNGR2 PE=2 SV=1 MES*3GAYGAPRAGGSFDLRRFLKQPQVVVRAVCLVFALIVFSCIFGEGYSNTHDSQQQYCV FNRNEDACRYGSAIGVLAFLASAFFFVVDIYFPQISNATDRKYLVIGDLLFSALWTFLWF VGFCFLTNQWAATKKNDVHVEADSARAAITFSFFSIFSWCVLAFLAYQRYKAGVDEFIQN YVDPTPDPSTAYASYPGVPADTYQQPPFTQNAESTEGYQPPPVY
Predicted Disorder Regions 196-224
DisProt Annotation
TM Helix Prediction 4TMHs; (27-49),(70-92),(104-126),(147-165)