Search by BoMiProt ID - Bomi9628


Primary Information

BoMiProt ID Bomi9628
Protein Name Synaptic vesicle glycoprotein 2A/p87
Organism Bos taurus
Uniprot IdQ29397
Milk FractionWhey
Ref Sequence Id NP_776387.1
Aminoacid Length 742
Molecular Weight 82589
Fasta Sequence https://www.uniprot.org/uniprot/Q29397.fasta
Gene Name SV2A
Gene Id 280936
Protein Existence Status reviewed

Secondary Information

Protein Function vesicular neurotransmitter transporters.a prototype synaptic vesicle protein regulating action potential-dependent neurotransmitters release. 
Biochemical Properties 12 transmembrane domains, with cytosolic N- and C-termini.
PTMs phosphorylation on Ser and Thr.N glycosylation on Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus OX=9913 GN=SV2A PE=2 SV=1 MEEGFRDRAAFIRGAKDIAKEVKKHATKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPA PADGYYRGEGAQDEEEGGAS*80S*81DAT*84EGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLA GVRGGLGDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQWTLYFVLGLALMADG VEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRF FLENGKHDEAWMVLKQVHDTNMRAKGHPERVFS*393VTHIKTIHQEDELIEIQSDTGAWYQRW GVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY*480 AARTKVFPGERVEHVTFN*498FTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVT SSNTFFRN*548CTFINTVFYNTDLFEYKFVNSRLVN*573STFLHNKEGCPLDVTGTGEGAYMVYFV SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGG VSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS AALALGSSLALKLPETRGQVLQ
Predicted Disorder Regions (3-151)
DisProt Annotation
TM Helix Prediction 12TMHs; (168-190), (205-223), (236-254), (258-280), (293-315), (330-352), (446-468), (596-618), ( 625-647), (651-669), (687-709),& (713-731)
Significance of PTMs glycosylation of luminal asparagine residues increases their size to ∼95 kDa for lightly glycosylated and ∼250 kDa for heavily glycosylated SV2 proteins.
Bibliography Stout KA, Dunn AR, Hoffman C, Miller GW. The Synaptic Vesicle Glycoprotein 2: Structure, Function, and Disease Relevance. ACS Chem Neurosci. 2019 Sep 18;10(9):3927-3938. doi: 10.1021/acschemneuro.9b00351. Epub 2019 Aug 23. PMID: 31394034.