Search by BoMiProt ID - Bomi9626


Primary Information

BoMiProt ID Bomi9626
Protein Name Synaptic vesicle 2-related protein/SV2-related protein
Organism Bos taurus
Uniprot IdQ1JP63
Milk FractionWhey
Ref Sequence Id NP_001068909.1
Aminoacid Length 548
Molecular Weight 60748
Fasta Sequence https://www.uniprot.org/uniprot/Q1JP63.fasta
Gene Name SVOP
Gene Id 510256
Protein Existence Status reviewed

Secondary Information

Protein Function transmembrane transporter activity at nerve terminals responsible for synaptic vesicle fusion.SV2 appears to facilitate the progression to a release-competent state after vesicle docking at the plasma membrane.
PTMs phosphorylation on Ser
Significance of PTMs . The three asparagines in the highly glycosylated lumenal domain between TM 7 and 8 domain are extensively modified with keratan sulfate moieties .This feature suggested that SV2 might provide a gel matrix to the inside of synaptic vesicles that would facilitate the concentration and release of transmitters.interaction of SV2 and synaptotagmin is regulated by phosphorylation.A conserved threonine in the amino terminus of all SV2s (Thr84 in SV2A) is a substrate for casein kinase 1. Phosphorylation of SV2A at this site increases binding to synaptotagmin.
Additional Comments SV2 is part of a protein complex that includes the synaptic vesicle protein synaptotagmin, the primary calcium sensor in regulated secretion.Loss of synaptotagmin abolishes synchronized transmitter release in response to action potentials
Linking IDs Bomi9626
Bibliography Ciruelas K, Marcotulli D, Bajjalieh SM. Synaptic vesicle protein 2: A multi-faceted regulator of secretion. Semin Cell Dev Biol. 2019 Nov;95:130-141. doi: 10.1016/j.semcdb.2019.02.003. Epub 2019 Mar 21. PMID: 30826548; PMCID: PMC6754320.
Protein Function transmembrane transporter activity at nerve terminals responsible for synaptic vesicle fusion.SV2 appears to facilitate the progression to a release-competent state after vesicle docking at the plasma membrane.
PTMs phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus OX=9913 GN=SVOP PE=2 SV=1 MEEDLFQLRQLPVVKFRRTGESARS*25EDDTAS*31GEHEVQIEGVRAGLEAVELDDGAAVPKEF ANPTDDTFMVEDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSW QVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLR GLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWL LILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQE DRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISSRKKAVEAK CSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVVFSFCSLLLFIC VGRNMLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQ VMLESSVYLTLAVYSGCCLLAALASCFLPIETKGRGLQESSHREWGQEMVGRGAHGTGVA RS*642NSGSQE
Predicted Disorder Regions 1-5, 19-66, 525-548
DisProt Annotation
TM Helix Prediction 10TMHs; (86-108), (120-142), (155-177),(181-203), (210-232), (236-258), (315-337), (376-394), (407-429), (486-508)
Significance of PTMs . The three asparagines in the highly glycosylated lumenal domain between TM 7 and 8 domain are extensively modified with keratan sulfate moieties .This feature suggested that SV2 might provide a gel matrix to the inside of synaptic vesicles that would facilitate the concentration and release of transmitters.interaction of SV2 and synaptotagmin is regulated by phosphorylation.A conserved threonine in the amino terminus of all SV2s (Thr84 in SV2A) is a substrate for casein kinase 1. Phosphorylation of SV2A at this site increases binding to synaptotagmin.
Additional Comments SV2 is part of a protein complex that includes the synaptic vesicle protein synaptotagmin, the primary calcium sensor in regulated secretion.Loss of synaptotagmin abolishes synchronized transmitter release in response to action potentials
Linking IDs
Bibliography Ciruelas K, Marcotulli D, Bajjalieh SM. Synaptic vesicle protein 2: A multi-faceted regulator of secretion. Semin Cell Dev Biol. 2019 Nov;95:130-141. doi: 10.1016/j.semcdb.2019.02.003. Epub 2019 Mar 21. PMID: 30826548; PMCID: PMC6754320.