Search by BoMiProt ID - Bomi9620


Primary Information

BoMiProt ID Bomi9620
Protein Name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related/SMARCE1-related protein/HMG box-containing protein 20B
Organism Bos taurus
Uniprot IdQ32L68
Milk FractionWhey
Ref Sequence Id NP_001033143.1
Aminoacid Length 317
Molecular Weight 35829
Fasta Sequence https://www.uniprot.org/uniprot/Q32L68.fasta
Gene Name HMG20B/SMARCE1R
Gene Id 507723
Protein Existence Status reviewed

Secondary Information

Protein Function  inhibitor of erythroid differentiation.suppresses embryonic β-like globins.
PTMs Phosphorylation on serine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32L68|HM20B_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Bos taurus OX=9913 GN=HMG20B PE=2 SV=1 MSHGPKQPGAASAPASGKAPGQHGSFVVAVKQERGEGPRAGEKGSHEEEPVKKRGWPKGK KRKKILPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPAEKQRYL DEAEREKQQYMKELRAYQQSEAYKMCAEKIQEKKIKKEDS*160SSGLMNTLLNGHKGGDCDGF STFDVPIFTEEFLDQNKAREAELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQELAL EERRTLALQQQLQAVRQALTASFASLPVPGTGETPTLSTLDFYMARLHGAIERDPAQHEK LIVRIKEILAQVASEHL
Predicted Disorder Regions 4 disordered segments; (1-107), (118-173), (216-228), (265-272)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Esteghamat F, van Dijk TB, Braun H, Dekker S, van der Linden R, Hou J, Fanis P, Demmers J, van IJcken W, Ozgür Z, Horos R, Pourfarzad F, von Lindern M, Philipsen S. The DNA binding factor Hmg20b is a repressor of erythroid differentiation. Haematologica. 2011 Sep;96(9):1252-60. doi: 10.3324/haematol.2011.045211. Epub 2011 May 23. PMID: 21606163; PMCID: PMC3166094.