Search by BoMiProt ID - Bomi9618


Primary Information

BoMiProt ID Bomi9618
Protein Name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1/60 kDa BRG-1/Brm-associated factor subunit A/BRG1-associated factor 60A/ BAF60A/SWI/SNF complex 60 kDa subunit
Organism Bos taurus
Uniprot IdQ2TBN1
Milk Fractionwhey
Ref Sequence Id NP_001033648.1
Aminoacid Length 515
Molecular Weight 58252
Fasta Sequence https://www.uniprot.org/uniprot/Q2TBN1.fasta
Gene Name SMARCD1/BAF60A
Gene Id 533232
Protein Existence Status Reviewed

Secondary Information

Protein Function Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner
Biochemical Properties SMARCAD1 contains two N-terminal CUE domains (CUE1, CUE2), which are equivalent to UBD.
PTMs Acetylation, methylation, phosphorylation,ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2TBN1|SMRD1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Bos taurus OX=9913 GN=SMARCD1 PE=2 SV=1 MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPR PGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSLKRPAPQQIKQVQQQAVQNRN HNAKKKKMADKILPQRIRELVPESQDYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKR KLRIFISNTFNPAKSDAEDGEGT*203VASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSL VIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPR LARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQR LHALLMPPEPIIINHVISVDPNDQKKTACYDIDEEVDDTLKTQMNSFLLSTASQQEIATL DNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKVMTDVVGNSEEERRAE FYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT
Predicted Disorder Regions 1-131, 194-201
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Ionizing radiation (IR) induces SMARCAD1 phosphorylation at a conserved T906 by ATM kinase, a modification essential for SMARCAD1 recruitment to DSBs.T906 phosphorylation is also important for SMARCAD1 ubiquitination by RING1 at K905.
Additional Comments SMARCAD1 facilitates the recruitment of BRCA1 at the DNA break site and that SMARCAD1 phosphorylation at T906 and its ATPase activity are required for BRCA1 localization at break sites.
Bibliography 1.Chakraborty, S., Pandita, R. K., Hambarde, S., Mattoo, A. R., Charaka, V., Ahmed, K. M., Iyer, S. P., Hunt, C. R., & Pandita, T. K. (2018). SMARCAD1 Phosphorylation and Ubiquitination Are Required for Resection during DNA Double-Strand Break Repair. iScience, 2, 123–135. https://doi.org/10.1016/j.isci.2018.03.016 2.van de Wijngaart, D. J., Dubbink, H. J., Molier, M., de Vos, C., Trapman, J., & Jenster, G. (2009). Functional screening of FxxLF-like peptide motifs identifies SMARCD1/BAF60a as an androgen receptor cofactor that modulates TMPRSS2 expression. Molecular endocrinology (Baltimore, Md.), 23(11), 1776–1786. https://doi.org/10.1210/me.2008-0280