Search by BoMiProt ID - Bomi9616


Primary Information

BoMiProt ID Bomi9616
Protein Name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1/BRG1-associated factor 47(BAF47)
Organism Bos taurus
Uniprot IdQ5BIN2
Milk FractionWhey
Ref Sequence Id NP_001035647.1
Aminoacid Length 385
Molecular Weight 44111
Fasta Sequence https://www.uniprot.org/uniprot/Q5BIN2.fasta
Gene Name SMARCB1/BAF47
Gene Id 537412
Protein Existence Status reviewed

Secondary Information

Protein Function SMARCB1/INI1 is one of the core subunit proteins of the ATP-dependent SWI/SNF chromatin remodeling complex, and is identified as a potent and bona fide tumor suppressor.
Biochemical Properties Plays a key role in cell-cycle control and causes cell cycle arrest in G0/G1. 
PTMs Isopeptide bond formation,Phosphorylation at Ser,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5BIN2|SNF5_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Bos taurus OX=9913 GN=SMARCB1 PE=2 SV=1 MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEER KKIVASSHGKKTKPNAKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYL REQKAKRNS*129QWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA SQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASA IRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSE LGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAE MEKKIRDQDRNTRRMRRLANTAPAW
Predicted Disorder Regions 1-5, 62-80, 107-138, 364-369, 376-384
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments  Aberrant expression of SMARCB1/INI1 has been found in various tumors such as epithelioid sarcomas, schwannomatosis, synovial sarcomas.
Bibliography 1.Kohashi K, Oda Y. Oncogenic roles of SMARCB1/INI1 and its deficient tumors. Cancer Sci. 2017 Apr;108(4):547-552. doi: 10.1111/cas.13173. Epub 2017 Apr 12. PMID: 28109176; PMCID: PMC5406539. 2.