Search by BoMiProt ID - Bomi9609


Primary Information

BoMiProt ID Bomi9609
Protein Name Survival motor neuron protein
Organism Bos taurus
Uniprot IdO18870
Milk FractionWhey
Ref Sequence Id NP_783632.1
Aminoacid Length 287
Molecular Weight 31327
Fasta Sequence https://www.uniprot.org/uniprot/O18870.fasta
Gene Name SMN1/SMN
Gene Id 281492
Protein Existence Status reviewed

Secondary Information

Protein Function catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs).Functioning of motor neurons.
PTMs Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O18870|SMN_BOVIN Survival motor neuron protein OS=Bos taurus OX=9913 GN=SMN1 PE=2 SV=2 MGGGGGGFPEPEDSVLFRRGT*21GES*24DDS*27DVWDDTALIKAYDKAVASFKHALKNGDISEASE KPKGT*65PKRKSAKNKSQRKNT*80TSPSKQWKVGDNCCAIWSEDGCIYPATIASIDFKRETCVV VYTGYGNREEQNLSDLLSPTSEVANIEQNAQENENESQISTDESENSSRSPLNKPNNIRS RAAPWNSFLPPPPHMPRSGLGPGKSGLNFSGPPPPPPPPPHFLSRWLPPFPAGPPMIPPP PPICPDSLDDADALGSMLISWYMSGYHTGYYMGFKQSQKEGRYSHFN
Predicted Disorder Regions 1-32, 40-89, 126-208, 217-222, 228-235, 245-250, 279-287
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments spinal muscular atrophy, is caused by loss or mutation of the survival motor neuron1 gene (SMN1) leading to reduced SMN protein levels and a selective dysfunction of motor neurons.
Bibliography 1.Burghes AH, Beattie CE. Spinal muscular atrophy: why do low levels of survival motor neuron protein make motor neurons sick? Nat Rev Neurosci. 2009 Aug;10(8):597-609. doi: 10.1038/nrn2670. Epub 2009 Jul 8. PMID: 19584893; PMCID: PMC2853768.