Search by BoMiProt ID - Bomi9574


Primary Information

BoMiProt ID Bomi9574
Protein Name Sulfatase-modifying factor 1/Formylglycine-generating enzyme
Organism Bos taurus
Uniprot IdQ0P5L5
Milk FractionWhey
Ref Sequence Id NP_001069544.1
Aminoacid Length 374
Molecular Weight 40342
Fasta Sequence https://www.uniprot.org/uniprot/Q0P5L5.fasta
Gene Name SUMF1
Gene Id 536435
Protein Existence Status reviewed

Secondary Information

Protein Function  is an O2 -utilizing oxidase that converts specific cysteine residues of client proteins to formylglycine.
Biochemical Properties Copper enzyme. CuI is an integral cofactor of this enzyme and binds with high affinity (KD =of 10-17 m) to a pair of active-site cysteines.
Significance in milk role in bovine testis metabolism
PTMs N-glycosylated. Contains high-mannose-type oligosaccharides.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0P5L5|SUMF1_BOVIN Formylglycine-generating enzyme OS=Bos taurus OX=9913 GN=SUMF1 PE=2 SV=1 MAAPALGPARGCGAELTLVLLLSLFLLLGWAAGGEEAGPEAGAPSLVGSCGCGNPQRPGA QGSSAAAHRYSREANAPGSVPGGRPSPPTKMVPIPAGVFTMGTDDPQIKQDGEAPARRVA IDAFYMDAYEVSNAEFEKFVN*147STGYLTEAEKFGDSFVFEGMLSEQVKSDIQQAVAAAPWW LPVKGANWRHPEGPDSTVLHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLQ NRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFRGTAPVDAFPPNGYGLYNIVGNAWE WTSDWWTVHHSAEETINPKGPPSGKDRVKKGGSYMCHKSYCYRYRCAARSQNTPDSSASN LGFRCAADHLPTTG
Predicted Disorder Regions 3 disordered segments; (34-115), (314-337), (371-374)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Knop M, Dang TQ, Jeschke G, Seebeck FP. Copper is a Cofactor of the Formylglycine-Generating Enzyme. Chembiochem. 2017 Jan 17;18(2):161-165. doi: 10.1002/cbic.201600359. Epub 2016 Dec 13. PMID: 27862795; PMCID: PMC5324649.