Search by BoMiProt ID - Bomi9570


Primary Information

BoMiProt ID Bomi9570
Protein Name Sugar phosphate exchanger 3/Solute carrier family 37 member 3
Organism Bos taurus
Uniprot IdQ17QZ3
Milk Fractionwhey
Ref Sequence Id NP_001068752.1
Aminoacid Length 495
Molecular Weight 54430
Fasta Sequence https://www.uniprot.org/uniprot/Q17QZ3.fasta
Gene Name SLC37A3/SPX3
Gene Id 506910
Protein Existence Status Reviewed

Secondary Information

Protein Function Required for the action of Nitrogen-containing-bisphosphonates in mammalian cells.SLC37A3 and ATRAID localize to lysosomes and are required for releasing N-BP molecules that have trafficked to lysosomes through fluid-phase endocytosis into the cytosol.Sugar phosphate exchanger 3 has a transmembrane transporter activity
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q17QZ3|SPX3_BOVIN Sugar phosphate exchanger 3 OS=Bos taurus OX=9913 GN=SLC37A3 PE=2 SV=1 MAWPRIFQRGALLSRFSHHHMVVFLLTFFSYSLLHASRKTFSNVKVSISKQWTPSAFN*58KS TELLPVEIWSSNHLFPSAEEATLFLGMLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGM CSSALVVFVFGTLTEWLHFYNKGLYCSLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVF GLWSACASVGNILGACLASSVLQYGYEYAFLVTAAVQFAGGIIIFFGLLVSPEEIGIPGI ETEDNFEEDSHRPLINGAENEDEAEPN*267YSIQEGNTVTQVKAISFYQACCLPGVIAYSLAY ACLKLVNYSFFFWLPFYLSNNFGWKEAEADQLSIWYDVGGIIGGTLQGFISDMLQKRAPV LALSLLLAIGSLVGYSRSPNDKSINALLMAVTGFFIGGPSNMISSAISADLGRQELIQGS SEALATVTGIVDGTGSIGAAVGQYLVSLIQDNLGWMWVFYFFILMTSCTVLFISPLIVRE TCSLMQRRQTRVLNE
Predicted Disorder Regions 240-271
DisProt Annotation
TM Helix Prediction 10 TMHs; (12-34), (85-107), (114-136), (148-170), (177-199), (208-230), (292-314), (333-351), (358-376), (456-478)
Significance of PTMs SLC37A3 exists predominantly in an un-glycosylated form.Only the glycosylated population of SLC37A3 interacted with ATRAID which together furthur induces releasing N-BP molecules.
Bibliography 1.Yu, Z., Surface, L. E., Park, C. Y., Horlbeck, M. A., Wyant, G. A., Abu-Remaileh, M., ... & O'Shea, E. K. (2018). Identification of a transporter complex responsible for the cytosolic entry of nitrogen-containing bisphosphonates. Elife, 7, e36620. 2.Cappello, A. R., Curcio, R., Lappano, R., Maggiolini, M., & Dolce, V. (2018). The Physiopathological Role of the Exchangers Belonging to the SLC37 Family. Frontiers in chemistry, 6, 122. https://doi.org/10.3389/fchem.2018.00122