Search by BoMiProt ID - Bomi9565


Primary Information

BoMiProt ID Bomi9565
Protein Name Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial/GTP-specific succinyl-CoA synthetase subunit beta/Succinyl-CoA synthetase beta-G chain
Organism Bos taurus
Uniprot IdQ3MHX5
Milk FractionWhey
Ref Sequence Id NP_001029811.1
Aminoacid Length 432
Molecular Weight 46691
Fasta Sequence https://www.uniprot.org/uniprot/Q3MHX5.fasta
Gene Name SUCLG2
Gene Id 537713
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells adrenal gland
Protein Function GTP-specific succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate.
PTMs N6-acetylation at lysine,Phosphorylation at Serine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3MHX5|SUCB2_BOVIN Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Bos taurus OX=9913 GN=SUCLG2 PE=2 SV=1 MAAPVGAQARKLLRDLVLRPPLLAARSQVVQLTSRRWLNLQEYQSKKLMSDNGVKVQRFF VADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPKVVGQLAKQM IGYNLATKQTPKEGVKVKKVMVAEALDISRETYLAILMDRS*161CNGPVLVGSPQGGVDIEEV AASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLKNQAADQIKKLYNLFLKIDATQV EVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAARYDLKYIGLD GNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILV NIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILSNSGLPITSAVDLED AAKKAVASVAKK
Predicted Disorder Regions 1-26, 427-432
DisProt Annotation
TM Helix Prediction No TM helices