Primary Information |
---|
BoMiProt ID | Bomi9564 |
---|
Protein Name | Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial/ATP-specific succinyl-CoA synthetase subunit beta/A-SCS/Succinyl-CoA synthetase beta-A chain/SCS-betaA |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q148D5 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001068961.1 |
---|
Aminoacid Length | 463 |
---|
Molecular Weight | 50130 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q148D5.fasta |
---|
Gene Name | SUCLA2 |
---|
Gene Id | 511090 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Protein Function | ATP-specific succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. |
---|
PTMs | Acetylation, Phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q148D5|SUCB1_BOVIN Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Bos taurus OX=9913 GN=SUCLA2 PE=2 SV=1
MAASVFYSRLLAAATLRSHRPRTALPAAAQVLGSSGLFNNHGVQIQHQQQRNLSLHEYLS
MELLQEAGVSIPKGHVAKSPDEAY*84AIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVK
IVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERRYPRREYYFAITMERSFQGP
VLIGSSHGGVNIEDVAAETPEAIVKEPIDIVEGIKKEQAVRLAQKMGFPASIVDSAAENM
IKLYDPFLKYDATMVEINPMVEDSDGAVLCMDAKINFDS*279NSAYRQKKIFDLQDWTQEDER
DKDAAKADLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGT*341PANFLDVGGGATVHQVTEA
FKLITSDKKVLSILVNIFGGIMRCDVIAQGIVMAVKDLEIKIPIVVRLQGTRVDDAKALI
ADSGLKILACDDLDEAAKMVVKLSEIVTLAKQAQVDVKFQLPI |
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Upon oxidative stress, the succinyl-coenzyme A (CoA) synthetase ADP-forming subunit β (SUCLA2) phosphorylated by p38 mitogen-activated protein kinase (MAPK) at S79 dissociates from GLS(kidney-type glutaminase), resulting in enhanced GLS K311 succinylation, oligomerization, and activity. Activated GLS increases glutaminolysis and the production of nicotinamide adenine dinucleotide phosphate (NADPH) and glutathione, thereby counteracting oxidative stress and promoting tumor cell survival and tumor growth in mice. |
---|
Bibliography | 1.Tong Y, Guo D, Lin SH, Liang J, Yang D, Ma C, Shao F, Li M, Yu Q, Jiang Y, Li L, Fang J, Yu R, Lu Z. SUCLA2-coupled regulation of GLS succinylation and activity counteracts oxidative stress in tumor cells. Mol Cell. 2021 Jun 3;81(11):2303-2316.e8. doi: 10.1016/j.molcel.2021.04.002. Epub 2021 May 14. PMID: 33991485. 2.El-Hattab, A. W., & Scaglia, F. (2009). SUCLA2-Related Mitochondrial DNA Depletion Syndrome, Encephalomyopathic Form with Methylmalonic Aciduria. In M. P. Adam (Eds.) et. al., GeneReviews®. University of Washington, Seattle. |