Search by BoMiProt ID - Bomi9564


Primary Information

BoMiProt ID Bomi9564
Protein Name Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial/ATP-specific succinyl-CoA synthetase subunit beta/A-SCS/Succinyl-CoA synthetase beta-A chain/SCS-betaA
Organism Bos taurus
Uniprot IdQ148D5
Milk FractionWhey
Ref Sequence Id NP_001068961.1
Aminoacid Length 463
Molecular Weight 50130
Fasta Sequence https://www.uniprot.org/uniprot/Q148D5.fasta
Gene Name SUCLA2
Gene Id 511090
Protein Existence Status Reviewed

Secondary Information

Protein Function ATP-specific succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA.
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q148D5|SUCB1_BOVIN Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Bos taurus OX=9913 GN=SUCLA2 PE=2 SV=1 MAASVFYSRLLAAATLRSHRPRTALPAAAQVLGSSGLFNNHGVQIQHQQQRNLSLHEYLS MELLQEAGVSIPKGHVAKSPDEAY*84AIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVK IVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERRYPRREYYFAITMERSFQGP VLIGSSHGGVNIEDVAAETPEAIVKEPIDIVEGIKKEQAVRLAQKMGFPASIVDSAAENM IKLYDPFLKYDATMVEINPMVEDSDGAVLCMDAKINFDS*279NSAYRQKKIFDLQDWTQEDER DKDAAKADLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGT*341PANFLDVGGGATVHQVTEA FKLITSDKKVLSILVNIFGGIMRCDVIAQGIVMAVKDLEIKIPIVVRLQGTRVDDAKALI ADSGLKILACDDLDEAAKMVVKLSEIVTLAKQAQVDVKFQLPI
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Upon oxidative stress, the succinyl-coenzyme A (CoA) synthetase ADP-forming subunit β (SUCLA2) phosphorylated by p38 mitogen-activated protein kinase (MAPK) at S79 dissociates from GLS(kidney-type glutaminase), resulting in enhanced GLS K311 succinylation, oligomerization, and activity. Activated GLS increases glutaminolysis and the production of nicotinamide adenine dinucleotide phosphate (NADPH) and glutathione, thereby counteracting oxidative stress and promoting tumor cell survival and tumor growth in mice.
Bibliography 1.Tong Y, Guo D, Lin SH, Liang J, Yang D, Ma C, Shao F, Li M, Yu Q, Jiang Y, Li L, Fang J, Yu R, Lu Z. SUCLA2-coupled regulation of GLS succinylation and activity counteracts oxidative stress in tumor cells. Mol Cell. 2021 Jun 3;81(11):2303-2316.e8. doi: 10.1016/j.molcel.2021.04.002. Epub 2021 May 14. PMID: 33991485. 2.El-Hattab, A. W., & Scaglia, F. (2009). SUCLA2-Related Mitochondrial DNA Depletion Syndrome, Encephalomyopathic Form with Methylmalonic Aciduria. In M. P. Adam (Eds.) et. al., GeneReviews®. University of Washington, Seattle.