Search by BoMiProt ID - Bomi9550


Primary Information

BoMiProt ID Bomi9550
Protein Name Stromal membrane-associated protein 2/Stromal membrane-associated protein 1-like
Organism Bos taurus
Uniprot IdQ5EA00
Milk Fractionwhey
Ref Sequence Id NP_001069138.1
Aminoacid Length 429
Molecular Weight 46900
Fasta Sequence https://www.uniprot.org/uniprot/Q5EA00.fasta
Gene Name SMAP2/SMAP1L
Protein Existence Status Reviewed

Secondary Information

Protein Function Stromal membrane-associated protein is basically GTPase activating protein that acts on ARF1. It can also activate ARF6. Additionally, it may also be involved in clathrin-dependent retrograde transport from early endosome to trans-Golgi network (TGN).
Biochemical Properties The polypeptide encoded by SMAP2 is composed of 428 aa residues and has a predicted molecular mass of 47 kDa.SMAP2 possesses a GAP domain and interacts with clathrin heavy chain (CHC).The amino-terminal region (aa 16-125) of SMAP2 harbors a conserved CX2CX16CX2C zinc finger motif and is strongly homologous to the corresponding region of SMAP1. Therefore, it is possible that SMAP2, like SMAP1, exhibits ArfGAP activity.The second conserved region of SMAP2 is contained by aa 173-212. This region harbors both classical and atypical CHC(clathrin)-binding motifs such as LLGLD (aa 187-191) and DLL (aa 212-214), respectively.LLGLD motif in SMAP1 functions as a CHC-binding motif
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5EA00|SMAP2_BOVIN Stromal membrane-associated protein 2 OS=Bos taurus OX=9913 GN=SMAP2 PE=2 SV=1 MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGV HISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDHAVEGFIRDKYEK KKYMDRS*127LDINAFRKEKDNKWKRGSEPAPEKKMEPVVFEKVKMPQKKEDPQLPRKTSPKS KAPVVDLLGLDAPVSCSIANGKTSNTLEKDLDLLASVSS*219PSSS*223VS*225RKVVGS*231MPTPGSAGS*240VPENLNLFPEPGSKSEETSKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSF PGVTPPNSLMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQA SYMAGMAAMPQTMYGVQPAQQLQWNLTQMTQQMAGMNFCGTNGMLSYGQSMNGGNGQAAN QTLSPQMWK
Predicted Disorder Regions 132-274, 287-326, 399-401, 410-429
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Natsume W, Tanabe K, Kon S, Yoshida N, Watanabe T, Torii T, Satake M. SMAP2, a novel ARF GTPase-activating protein, interacts with clathrin and clathrin assembly protein and functions on the AP-1-positive early endosome/trans-Golgi network. Mol Biol Cell. 2006 Jun;17(6):2592-603. doi: 10.1091/mbc.e05-10-0909. Epub 2006 Mar 29. PMID: 16571680; PMCID: PMC1475504. 2.Harhay, G. P., Sonstegard, T. S., Keele, J. W., Heaton, M. P., Clawson, M. L., Snelling, W. M., Wiedmann, R. T., Van Tassell, C. P., & Smith, T. P. (2005). Characterization of 954 bovine full-CDS cDNA sequences. BMC genomics, 6, 166. https://doi.org/10.1186/1471-2164-6-166