Search by BoMiProt ID - Bomi9548


Primary Information

BoMiProt ID Bomi9548
Protein Name Striatin-3
Organism Bos taurus
Uniprot IdA5D7H2
Milk FractionWhey
Ref Sequence Id NP_001091511.1
Aminoacid Length 797
Molecular Weight 87423
Fasta Sequence https://www.uniprot.org/uniprot/A5D7H2.fasta
Gene Name STRN3
Gene Id 516375
Protein Existence Status reviewed

Secondary Information

Protein Function Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5D7H2|STRN3_BOVIN Striatin-3 OS=Bos taurus OX=9913 GN=STRN3 PE=2 SV=1 MDELAGGGGGGPAMASPPRQQQGPGGNMSLSPGGNGAAGGGGPPATEGAGPAAGPELSRP QQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKM LEYALKQERAKYHKLKYGTELNQGDLKMPT*150FESEETKDTEAPTAPQNSQLTWKQGRQLLR QYLQEVGYTDTILDVRSQRVRS*202LLGLSNSEPNGS*214VETKNLEQILNGGES*229PKQKGQEIKRT SGDVLETFNFLENADDS*257DEEEENDMIEGIPEGKDKHRINKHKIGNEGLAADLTDDPDTEE ALKEFDFLVTAEDGEGAGEARSSGDGTEWDKDDLS*335PTTEVWDVDQGLISKLKEQYKKERK GKKGVKRVNRTKLYDTIADLGDDELPLIPSGIINQSRSASTRMTDHEGARAEEAEPITFP SGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDADYSYDLPANKDAFRKTWNPKYTLRSHF DGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKKSASLDVEPIYTFRAHIGPVLSLA ISSNGEQCFSGGTDATIQWWNMPSPNVDPYDTYEPNVLAGTLIAHTDAVWGLAYSGIKNQ LLSCSADGTVRLWNPQEKLPCICTYNGDKEHGIPTSVDFIGCDPAHMVTSFNTGSTVIYD LETSQSLVMLSSQMDSGLQSSNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMV AHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHPS KAYIASAGADALAKVFV
Predicted Disorder Regions 1-57, 161-170, 222-332, 355-362
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs Phosphorylation of striatin by ULK1 promotes functional autophagy.
Bibliography 1.Hu Z, Sankar DS, Vu B, Leytens A, Vionnet C, Wu W, Stumpe M, Martínez-Martínez E, Stork B, Dengjel J. ULK1 phosphorylation of striatin activates protein phosphatase 2A and autophagy. Cell Rep. 2021 Sep 28;36(13):109762. doi: 10.1016/j.celrep.2021.109762. PMID: 34592149. 2.Nader, M., Khalil, B., Kattuah, W., Dzimiri, N., & Bakheet, D. (2020). Striatin translocates to the cytosol of apoptotic cells and is proteolytically cleaved in a caspase 3-dependent manner. Heliyon, 6(9), e04990. https://doi.org/10.1016/j.heliyon.2020.e04990