Search by BoMiProt ID - Bomi9538


Primary Information

BoMiProt ID Bomi9538
Protein Name Stress-70 protein, mitochondrial/75 kDa glucose-regulated protein/Heat shock 70 kDa protein 9/GRP-75
Organism Bos taurus
Uniprot IdQ3ZCH0
Milk FractionWhey
Ref Sequence Id NP_001029696.1
Aminoacid Length 679
Molecular Weight 73742
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZCH0.fasta
Gene Name HSPA9
Gene Id 517535
Protein Existence Status reviewed

Secondary Information

Protein Function During exogenous stress,there is rapid gene expression.
Significance in milk in the saliva of dairy cows
PTMs Acetylation, Methylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZCH0|GRP75_BOVIN Stress-70 protein, mitochondrial OS=Bos taurus OX=9913 GN=HSPA9 PE=2 SV=1 MISASRAAVSRFVGTAASRGPTAARHQDGWNGLSHEAFRIVSRRDYASEAIKGAVVGIDL GTTNSCVAVMEGKQAKVLENAEGARTT*87PSVVAFTADGERLVGMPAKRQAVTNPNNTFYAT KRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAEN YLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKII AVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTK DNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVTDLIR RTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPS*408KAVNPDEAVAIG AAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQT QVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTG REQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFK DQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASERE GSGSSGTGEQKDNQKEEKQ
Predicted Disorder Regions (655-679)
DisProt Annotation
TM Helix Prediction No TM helices