Search by BoMiProt ID - Bomi9527


Primary Information

BoMiProt ID Bomi9527
Protein Name Sterol regulatory element-binding protein cleavage-activating protein/SREBP cleavage-activating protein/SCAP
Organism Bos taurus
Uniprot IdA6QM06
Milk FractionWhey
Ref Sequence Id NP_001095359.1
Aminoacid Length 1278
Molecular Weight 139701
Fasta Sequence https://www.uniprot.org/uniprot/A6QM06.fasta
Gene Name SCAP
Gene Id 507878
Protein Existence Status reviewed

Secondary Information

Protein Function Regulation of cholesterol homeostasis.An important role of SCAP-SREBP2 that is directly used by NLRP3 for inflammasome activation, thus suggesting an intimate metabolic-inflammatory crosstalk in pro-inflammatory macrophages.
Biochemical Properties In addition to controlling cholesterol biosynthesis, SCAP-SREBP2 also serves as a signaling hub integrating cholesterol metabolism with inflammation in macrophages.
Significance in milk A ubiquitous expression profile of SCAP gene was detected in various tissues with extreme predominance in the mammary gland during early lactation.Buffalo SCAP could sever as a candidate gene affecting milk production traits in buffalo and the identified SNPs might potentially be genetic markers.
PTMs N-Linked Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QM06|SCAP_BOVIN Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus OX=9913 GN=SCAP PE=2 SV=1 MTLTERLREKISQAFYNHGLFCASYPIPIILFTGLCILACCYPLLKLPLPGTGPVEFTTP VKDYSPPPLTSDHKPGEPNEQPEWYVGAPVAYIQQIFVKSSVSPWHKNLLAVDVFRSPLS RAFQLVEEIRNHVLKDSSGTRSLEDVCLQVTDLLPGLRKLRNLLPEHGCLLLSPGNFWQN DRERFHADPDIIRTIHQHEPKTLQTSATLKDLLFGVPGKYSGVSLYTRKRLVSYTITLVF QHYHAKFLGSLRARLMLLHPSPN*263CSLRAESLVHVHFKEEIGIAELIPLVTTYIILFAYIY FSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGEIFPYLVVVIGLEN VLVLTKSVVSTPVDLEVKLRIAQGLSSESWSIMKNMATELGIVLIGYFTLVPAIQEFCLF AVVGLVSDFFLQMLFFTTVLSIDIRRMELADLNKRLPPEACLPPAKPVGRPTRFERQPTV RPSMPHTITLQPSSFRNLRLPKRLRVIYFLARTRLAQRLIMAGTVVWIGILVYTDPAGLR TYLAAQVTEQSPLGEGALAPLPVPSGVLPASHPDPAFSIFPPDASKLPEN*590QTLPGEPPEP GGLAEGVHDSPAPEVTWGPEDEELWRKLSFRHWPTLFSYYN*641ITLAKRYVSLLPVIPVTLR LNPREALEGRHPQDGRSAWPPPRPGQGGLWEAGPKGPGTAQAQRDLTLYKVAALGLASGI VLVLLLLCLYRVLCPRNYGQPGAGPGRRRRGELPCDDYGYAPPETEIVPLVLRGHLMDIE CLASDGMLLVSCCLAGHVCVWDAQTGDCLTRIPHPGQRRDS*821GVGSGLETQETWERLS*837DGG KGGPEEPGDS*850PPLRHRPRGPPPPALFGDQPDLTCLIDTNFSARPQLPEPAQPEPRYRAGR RAQDS*905AGYDFSRLVQRVYQEGGMAPVHTPALRPPS*935PGPTFPLAPEDEAGFPPEKSCPSLA WAPSTDGSIWSLELQGSLIVVGRSSGRLEVWDAIEGTLRCSSEEVSSGITALVFLDRRIV AARLNGSLDFFSLETHTALSPLQFRGAPGRGSSPASPACSSSDRVACHLTHTVPCAHQKP ITALKAAAGRLVTGSQDHTLRVFRLEDSCCLFTLQGHSGAITTVYIDQTMVLASGGQDGA ICLWDVLTGSRVSHMFAHRGDVTSLTCTTSCVISSGLDDLISIWDRSTGIKLYSIQQDLG CGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVCN FGSELSLVYVPSVLEKLD
Predicted Disorder Regions 65-72, 836-846, 880-893, 934-951
DisProt Annotation
TM Helix Prediction 7TMHs; (20-42), (280-302), (315-333), (348-370), (403-425), (515-533), (711-733)
Significance of PTMs N-glycosylation of SCAP Is Essential for SREBP-1 Activation and Tumor Growth
Additional Comments NLRP3 associated with SCAP-SREBP2 to form a ternary complex which translocated to the Golgi apparatus adjacent to a mitochondrial cluster for optimal inflammasome assembly. 
Bibliography 1.Guo C, Chi Z, Jiang D, Xu T, Yu W, Wang Z, Chen S, Zhang L, Liu Q, Guo X, Zhang X, Li W, Lu L, Wu Y, Song BL, Wang D. Cholesterol Homeostatic Regulator SCAP-SREBP2 Integrates NLRP3 Inflammasome Activation and Cholesterol Biosynthetic Signaling in Macrophages. Immunity. 2018 Nov 20;49(5):842-856.e7. doi: 10.1016/j.immuni.2018.08.021. Epub 2018 Oct 23. PMID: 30366764. 2.Cheng C, Ru P, Geng F, Liu J, Yoo JY, Wu X, Cheng X, Euthine V, Hu P, Guo JY, Lefai E, Kaur B, Nohturfft A, Ma J, Chakravarti A, Guo D. Glucose-Mediated N-glycosylation of SCAP Is Essential for SREBP-1 Activation and Tumor Growth. Cancer Cell. 2015 Nov 9;28(5):569-581. doi: 10.1016/j.ccell.2015.09.021. PMID: 26555173; PMCID: PMC4643405. 2.Deng T, Ma X, Pang C, Liang S, Lu X, Duan A, Liang X. Molecular characterisation of the buffalo SCAP gene and its association with milk production traits in water buffaloes. J Dairy Res. 2018 May;85(2):133-137. doi: 10.1017/S0022029918000195. PMID: 29785906.