Search by BoMiProt ID - Bomi9476


Primary Information

BoMiProt ID Bomi9476
Protein Name Spondin-1
Organism Bos taurus
Uniprot IdQ9GLX9
Milk FractionWhey
Ref Sequence Id NP_777168.1
Aminoacid Length 807
Molecular Weight 90976
Fasta Sequence https://www.uniprot.org/uniprot/Q9GLX9.fasta
Gene Name SPON1
Gene Id 282866
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells secreted by cells of the floor plate and may be involved in axon guidance.
Protein Function SPON1 Can Reduce Amyloid Beta and Reverse Cognitive Impairment and Memory Dysfunction in Alzheimer's disease mice model.Cell adhesion protein that promotes the attachment of spinal cord and sensory neuron cells and the outgrowth of neurites
Biochemical Properties is an extracellular matrix protein, consisting of three domains: spondin, reelin, and thrombospondin, and plays an essential role in neuronal survival and the migration of commissural axons.binds to the BACE1 cleavage site of APP and prohibits APP from being cleaved and released as the Aβ form
Significance in milk a mitogenic factor
PTMs Disulfide bond formation, Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9GLX9|SPON1_BOVIN Spondin-1 OS=Bos taurus OX=9913 GN=SPON1 PE=1 SV=1 MRLSPVLLRLSRGPALLALALPLAVALAFSDETLDKVPKSEGYCSRILRVQGTRREGYTE FSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALKENREGDKEEDHAGTFQIIDEE ETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKK LCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHS KNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPLNVRAA PSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSG VTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPD NVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPC PDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGTGTRSRERYVKQFPEDGSVCTL PTEETEKCTVNEECSPSSCLTTEWGEWDECSATCGMGMKKRHRMVKMSPADGSMCKAETS QAEKCMMPECHTIPCLLSLWSEWSDCSVTCGKGMRTRQRMLKSLAELGDCNEELEQVEKC MLPECPIDCELTEWSQWSECN*681KSCGKGHMIRTRMIQMEPQFGGTPCPETVQRKKCRIRKC LRNPSIQNLRWREARESRRSEQLREESDGDQFPGCRMRPWTAWSECTKLCGGGIQERYMT VKKRFKSSQFTSCKDKKEIRACNVHPC
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Park SY, Kang JY, Lee T, Nam D, Jeon CJ, Kim JB. SPON1 Can Reduce Amyloid Beta and Reverse Cognitive Impairment and Memory Dysfunction in Alzheimer's Disease Mouse Model. Cells. 2020 May 21;9(5):1275. doi: 10.3390/cells9051275. PMID: 32455709; PMCID: PMC7290723.