Search by BoMiProt ID - Bomi9474


Primary Information

BoMiProt ID Bomi9474
Protein Name Splicing factor U2AF 35 kDa subunit
Organism Bos taurus
Uniprot IdA1A4K8
Milk FractionWhey
Ref Sequence Id NP_001073737.1
Aminoacid Length 237
Molecular Weight 27701
Fasta Sequence https://www.uniprot.org/uniprot/A1A4K8.fasta
Gene Name U2AF1
Gene Id 512680
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Expressed in pituitary gland and 97 other tissues
Protein Function Splicing event.It is a RNA-binding protein, is involved in the recognition of the 3′ splice site required for the recruitment of the U2 snRNP during pre-mRNA splicing.important for maintenance and function of HSPC in normal hematopoiesis.
PTMs Acetylation, Methylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A1A4K8|U2AF1_BOVIN Splicing factor U2AF 35 kDa subunit OS=Bos taurus OX=9913 GN=U2AF1 PE=2 SV=1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQ S*61ADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE EDAEKAVIDLNNRWFNGQPIHAELS*145PVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE LRRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGRERDRRRSRDRERSGRF
Predicted Disorder Regions 180-237
DisProt Annotation
TM Helix Prediction No TM helices