Search by BoMiProt ID - Bomi9467


Primary Information

BoMiProt ID Bomi9467
Protein Name Splicing factor 3B subunit 3/Pre-mRNA-splicing factor SF3b 130 kDa subunit/SF3b130/Spliceosome-associated protein 130/SAP 130
Organism Bos taurus
Uniprot IdA0JN52
Milk FractionWhey
Ref Sequence Id NP_001071319.1
Aminoacid Length 1217
Molecular Weight 135577
Fasta Sequence https://www.uniprot.org/uniprot/A0JN52.fasta
Gene Name SF3B3
Gene Id 504962
Protein Existence Status reviewed

Secondary Information

Protein Function Interacts with HIV Tat and Plays a Role in Viral Transcription and Reactivation from Latency
Biochemical Properties SF3B1 inhibition can reduce acetylated histone H3K36me3 levels
PTMs Phoshorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A0JN52|SF3B3_BOVIN Splicing factor 3B subunit 3 OS=Bos taurus OX=9913 GN=SF3B3 PE=2 SV=1 MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFG VIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQF LAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISS*156PLEAHKANTLVYHVVGVDVGFENP MFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFF FLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQ IAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDT PQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPG KKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQ RSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSI GFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFP LQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAA AFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTG EDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQ LIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRG LLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDF FQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT*1200 PPEVSKKLEDIRTRYAF
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction no TM helices
Additional Comments SF3B1 interacted with viral protein Tat in vitro and in vivo Genetic or pharmacologic inhibition of SF3B1 prevented Tat-mediated HIV transcription and RNA polymerase II association with the HIV promoter.
Bibliography Kyei GB, Meng S, Ramani R, Niu A, Lagisetti C, Webb TR, Ratner L. Splicing Factor 3B Subunit 1 Interacts with HIV Tat and Plays a Role in Viral Transcription and Reactivation from Latency. mBio. 2018 Nov 6;9(6):e01423-18. doi: 10.1128/mBio.01423-18. PMID: 30401776; PMCID: PMC6222122.