Search by BoMiProt ID - Bomi9464


Primary Information

BoMiProt ID Bomi9464
Protein Name Spliceosome-associated protein CWC15 homolog
Organism Bos taurus
Uniprot IdQ2KJD3
Milk FractionWhey
Ref Sequence Id NP_001039864.1
Aminoacid Length 231
Molecular Weight 26869
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJD3.fasta
Gene Name CWC15
Gene Id 535258
Protein Existence Status reviewed

Secondary Information

Protein Function associates with CDC5L and maintain to maintain Prp19 spliceosomal complex.to maintain the integrity of the complex and to support efficient splicing.
Biochemical Properties crooslinks are formed between K28 at the N-terminus of CDC5L and K92 of CWC15 .
PTMs Acetylation on Lys and Thr, Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJD3|CWC15_BOVIN Spliceosome-associated protein CWC15 homolog OS=Bos taurus OX=9913 GN=CWC15 PE=2 SV=1 MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTT*47QDAPEEVRNRDFR RELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLT*110DEEDEDEDFE EES*123DDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQP QANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK
Predicted Disorder Regions 1-192, 198-209, 216-231
DisProt Annotation
TM Helix Prediction no TM helices
Bibliography van Maldegem F, Maslen S, Johnson CM, Chandra A, Ganesh K, Skehel M, Rada C. CTNNBL1 facilitates the association of CWC15 with CDC5L and is required to maintain the abundance of the Prp19 spliceosomal complex. Nucleic Acids Res. 2015 Aug 18;43(14):7058-69. doi: 10.1093/nar/gkv643. Epub 2015 Jun 29. PMID: 26130721; PMCID: PMC4538830.