Search by BoMiProt ID - Bomi9459


Primary Information

BoMiProt ID Bomi9459
Protein Name Spindle and centriole-associated protein 1/Coiled-coil domain-containing protein 52
Organism Bos taurus
Uniprot IdQ2T9X8
Milk FractionWhey
Aminoacid Length 860
Molecular Weight 95713
Fasta Sequence https://www.uniprot.org/uniprot/Q2T9X8.fasta
Gene Name SPICE1/CCDC52
Gene Id 515350
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells spindle microtubules
Protein Function required for centriole duplication and for proper bipolar spindle formation and chromosome congression in mitosis.Centriole elongation
Biochemical Properties well conserved two potential coiled-coil regions (CC1 and CC2). central conserved CC1 region is involved in centriole localization.
PTMs phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2T9X8|SPICE_BOVIN Spindle and centriole-associated protein 1 OS=Bos taurus OX=9913 GN=SPICE1 PE=2 SV=1 MSFVRVNRYGPRGGGRKTLKVKKKTSVKQEWDNTVTDLTVHRATPEDLIRRHEIHKSKNR ALVHWELQEKALKRRWKKQKPEISNLEKRRLSIMKEILSDQYQLQDVLEKSDHLMATAKG LFVDFPRRRTGFPNVTMAPESSQSPTVVSKDPVTQAIRSESVIEPQALNEVDDDEQEGTV NSQSEESENELDNSLSSQSNANAGTFLHQIKEENSELINKLWTDIQQKVATQSQMT*236ASSG TPSSASPSGEQKAALNATNAVKRIHTRLQPEESTETLDSSYVVGQVLNSRKQKQLLNKVK RKPDSRAPSKQKSSMLSASTASTDLPSSSNPSLDVLKHMIHEVEHEIEEYERWTGREVQG LQNSQGLTGFTLSLVSSLCRLVRYLKESELQLRKEVETRQRLEEALGDHRELIDALTAEV LFLREENTATQARLQQYMITTDEQLISLTHAIKNCPVISNKESQALERGATSQRHIDNPE DPAVNASVSMPLMFRGEDVVEFPQEDLPVKLSQVPNPPESGDLASSLPGHIFEPAVLLTP PRQKSNSEFSPLQDVLRRTVQTRPAPRIPPTVEIIEKEQNWEKKTLPVGADIQNSSDESH LFTQRWRASHMGEDSQSKTQAPFVSLSQPLCSSQSSMQQSRNPTLS*646EEPLVLGDGQQLRT NETLIQRKDIMARIAELTLQNSDIRAHLNNIIGPGGEQGDGLREFNRQETSHASDTMATF PAVQPLTPSSMEERIAELNRQSMEARGKLLQLIEQQKLLGLNPSS*765PPVS*769PVQSPLRAWAE GGKRTIEVSIPGAEAPESSKCSTDSPTSGLNSRRSSGAASNSCS*824PLNATSGSGRLTPLNP RAKIEKQNEEGWFALSTHVS
Predicted Disorder Regions 13-26, 154-222, 242-258, 295-328, 613-653, 711-718, 797-831
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Constitutive phosphorylation of SPICE1 c terminal region by Aurora Kinase results in abnormal centriole number, chromosome alignment defects and spindle multipolarity.In the absence of Aurora kinase activity, SPICE1 remains at centrioles but does not target to the spindle.549–855 residues of SPICE1, as a novel substrate of Aurora kinases in cells.
Additional Comments Depletion of SPICE causes defects in the mitotic spindle and impairs chromosome congression
Bibliography 1.Archinti M, Lacasa C, Teixidó-Travesa N, Lüders J. SPICE--a previously uncharacterized protein required for centriole duplication and mitotic chromosome congression. J Cell Sci. 2010 Sep 15;123(Pt 18):3039-46. doi: 10.1242/jcs.069963. Epub 2010 Aug 24. PMID: 20736305.2.Comartin D, Gupta GD, Fussner E, Coyaud É, Hasegan M, Archinti M, Cheung SW, Pinchev D, Lawo S, Raught B, Bazett-Jones DP, Lüders J, Pelletier L. CEP120 and SPICE1 cooperate with CPAP in centriole elongation. Curr Biol. 2013 Jul 22;23(14):1360-6. doi: 10.1016/j.cub.2013.06.002. Epub 2013 Jun 27. PMID: 23810536. 3.Deretic J, Kerr A, Welburn JPI. A rapid computational approach identifies SPICE1 as an Aurora kinase substrate. Mol Biol Cell. 2019 Feb 1;30(3):312-323. doi: 10.1091/mbc.E18-08-0495. Epub 2018 Nov 28. PMID: 30485161; PMCID: PMC6589576.