Search by BoMiProt ID - Bomi9446


Primary Information

BoMiProt ID Bomi9446
Protein Name Spermatogenesis-associated protein 6
Organism Bos taurus
Uniprot IdQ2KJG1
Milk FractionWhey
Aminoacid Length 487
Molecular Weight 56137
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJG1.fasta
Gene Name SPATA6
Protein Existence Status reviewed

Secondary Information

Protein Function involved in myosin-based microfilament transport through interaction with myosin subunits (e.g., MYL6).
Biochemical Properties 488 amino acids long,bins to MYL6
PTMs Glycosylation, Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJG1|SPAT6_BOVIN Spermatogenesis-associated protein 6 OS=Bos taurus OX=9913 GN=SPATA6 PE=2 SV=2 MPKVKALQCALALEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPANFPLVFNARMV FEKVFPEAVDPGDVVAQLEYDTALFELIQLVPPVGETLSTYDENTRDFMFPGPNQISGHH DSNRQVTMRRISGLRGIAPKLEFSTTSVITECLISSRKCRTQDKFVYHTAPVEKPHSRLQ N*181RTSRSQKKKSKSPERNKYCINAKNYEQPTTSKSHS*216PS*218PYTKRRMCELSEDTRRRLAHLN LGPYEFKKETDKPPFVIRHVDPPS*264PRADALFGS*273PGRDCERDGWSRLHNDHSHLGCYRPKD YKVIRTPHGRDFDESLERCEDYLS*324SRSCSKPQHSARTLLVHS*342APS*345TMPKHSPS*353PVLNRASLRERFHSDWCSPSNCDEIHDRVKNVLKSHQAHQRHLYDERDPEKEDELELKRGLLYRDSA YDS*423DPEYSSFQRPRGTLHLDDGEYWSNRAASYKGKSHRPIFENS*464MDKIYRNLYKKACSSV SHTQES*486F
Predicted Disorder Regions 111-119, 179-219, 252-267, 328-358, 399-405, 423-430,
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Inactivation of SPATA6 leads to male infertility and teratospermia.down-regulation of SPATA6 can induce apoptosis .
Bibliography 1.Huo S, Du W, Shi P, Si Y, Zhao S. The role of spermatogenesis-associated protein 6 in testicular germ cell tumors. Int J Clin Exp Pathol. 2015 Aug 1;8(8):9119-25. PMID: 26464655; PMCID: PMC4583887. 2.Yuan S, Stratton CJ, Bao J, Zheng H, Bhetwal BP, Yanagimachi R, Yan W. Spata6 is required for normal assembly of the sperm connecting piece and tight head-tail conjunction. Proc Natl Acad Sci U S A. 2015 Feb 3;112(5):E430-9. doi: 10.1073/pnas.1424648112. Epub 2015 Jan 20. PMID: 25605924; PMCID: PMC4321249.