Search by BoMiProt ID - Bomi9410


Primary Information

BoMiProt ID Bomi9410
Protein Name Sorting nexin-29
Organism Bos taurus
Uniprot IdQ08DX0
Milk FractionWhey
Ref Sequence Id NP_001070330.1
Aminoacid Length 817
Molecular Weight 91337
Fasta Sequence https://www.uniprot.org/uniprot/Q08DX0.fasta
Gene Name SNX29
Gene Id 518366
Protein Existence Status reviewed

Secondary Information

Protein Function SNX29 was involved in the regulation of a number of biological processes, such as TGF-beta, ErbB, and Wnt signalling pathway.SNX29 gene played a significant role in the development of schizophrenia (SCZ), bipolar disorder (BPD) or major depressive disorder (MDD) disorders in the Han Chinese population.
Biochemical Properties enable phosphatidylinositol binding activity
Significance in milk associated with body size and weight.
PTMs Phosphorylation at Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DX0|SNX29_BOVIN Sorting nexin-29 OS=Bos taurus OX=9913 GN=SNX29 PE=2 SV=1 MSGTQNNDMKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLKR SRGLALTAAAIKQAAGFASKTETEPVFWFYVKEVLSKHELQRFHALRHIASDVGRGRAWL RCALNENSLERYLHMLLADRGRLSTFYEDWAFVMDEERSSMLPTMAAGLNSILFAINIDN KDLNGQSKFAPTVSDLLKESTQNVTSLLKESTQGVSSLFREITASSAVSILSRAEQETDP LPVVSKHVSADAKCKRERKKKKKVTNIIS*269FDDEEDEQSSGDVFKKIPGAGES*292S*293EENSDRS SINIMSAFESPFGPNSNGSQGSNSWKIDSLS*331LNGEFGYQKLDVKS*345IDDEDADENEDDVCG SMPGRKRPGHSESPEKPLDAGTCLSQMHGWAPLQVLHGHAEVLFPVSGVGSYGPADAPLG SLENGTGPEDHILPEPGPRYSVEASPPGQES*451PLSSLLPSASVPESMTVSDLRQAIVAMMN RKDELEEENRSLRNLLDGEMEHSAALRQEVDTLKRKVAEQEERHVTKVQALARENEVLKV QLKKYVGAVQMLKREGQTAEVVPNLWNIDGEVTVPEQKPGEVAEELTSSYERKLIEVAEM HGELIEFNERLHRALVAKEALVSQMRQELIDLRGPVPGDLS*641QT*643S*644EDQS*648LSDFEISNRALINVWIPSVFLRGKAANAFHVYQVYIRIKDDEWNVYRRYAEFRTLHHKLQNKYPQVRAFNFP PKKAIGNKDAKFVEERRKQLQTYLRSVMNKVIQAVPEFTASPQKETLTQLMPFFVDITPP GDALTKNSRPKVASRFPKLARGHPRETRNVEPQSGDL
Predicted Disorder Regions 247-330, 350-356, 435-459
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Leads to genetic instability causing mental disorders
Bibliography 1.Chen JH, Zhao Y, Khan RAW, Li ZQ, Zhou J, Shen JW, Xiang SY, Li NN, Wen ZJ, Jian XM, Song ZJ, Stewart R, Wang Z, Pan D, He L, Xu YF, Shi YY. SNX29, a new susceptibility gene shared with major mental disorders in Han Chinese population. World J Biol Psychiatry. 2021 Sep;22(7):526-534. doi: 10.1080/15622975.2020.1845793. Epub 2020 Dec 8. PMID: 33143498.