Search by BoMiProt ID - Bomi9369


Primary Information

BoMiProt ID Bomi9369
Protein Name Solute carrier family 43 member 3
Organism Bos taurus
Uniprot IdQ1JPD8
Milk FractionWhey
Ref Sequence Id NP_001033215.1
Aminoacid Length 489
Molecular Weight 54424
Fasta Sequence https://www.uniprot.org/uniprot/Q1JPD8.fasta
Gene Name SLC43A3
Gene Id 516840
Protein Existence Status reviewed

Secondary Information

Protein Function Involved in the transport endogenous nucleobases,identified as a purine-selective nucleobase transporter.
PTMs Phosphorylation at Ser/Thr, Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1JPD8|S43A3_BOVIN Equilibrative nucleobase transporter 1 OS=Bos taurus OX=9913 GN=SLC43A3 PE=2 SV=1 MQGRSLPFRVATLVTGLLECLGFAGVLFGWTSLVFVFKKQHYFEELCELDAGSLGN*56ATGL DECRARDERFSLIFTLASFTINFMTFPTGYIFDRFKTTVARLIAIFLYTSATLTIAFTSA DSAVLLFLAMPMLAVGGILFLITNLQIGNLFGKHRSTIITMYNGAFDSSSAVFLIIKLLY EQGVTIKASFLFISVCSAWHVGRTLLLMPRGHIPYPLPANYHYGLCSRDSPPEEDKKEAE SEKLELQSKEFLS*253PKKET*258PGQQQAPGSFWSHTFSPRFAWHVVWLSVIQLWHYLFIGTLNS LLNNLASRDSAIVSTYTNAFAVTQFFGVLCAPWNGLLMDRLKHKYQEEAKRTGAVAKAAA LRSVVPSLTLTSLLSLGFAVCASIPVLPLQYATFILQVVSRSFLYGCNAAFLTLAFPSEH FGKLFGLVMALSAVVSLLQFPLFTLIKGPLQNDPLYVNLMLVLLTLLTFIHPFLVNRECQ RKESPREVA
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 12TMHs ; (13-35), (70-92), (99-117), (123-145), (158-180), (184-202), (278-296), (315-337), (358-380), (395-417), (424-446), (455-473)
Bibliography 1.Takenaka R, Yasujima T, Furukawa J, Hishikawa Y, Yamashiro T, Ohta K, Inoue K, Yuasa H. Functional Analysis of the Role of Equilibrative Nucleobase Transporter 1 (ENBT1/SLC43A3) in Adenine Transport in HepG2 Cells. J Pharm Sci. 2020 Aug;109(8):2622-2628. doi: 10.1016/j.xphs.2020.04.013. Epub 2020 Apr 25. PMID: 32339528. 2.