Search by BoMiProt ID - Bomi9316


Primary Information

BoMiProt ID Bomi9316
Protein Name Solute carrier family 22 member 17/24p3 receptor/Lipocalin-2 receptor
Organism Bos taurus
Uniprot IdQ3SZQ2
Milk FractionWhey
Ref Sequence Id NP_001124227.1
Aminoacid Length 567
Molecular Weight 60174
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZQ2.fasta
Gene Name SLC22A17
Gene Id 539848
Protein Existence Status reviewed

Secondary Information

Protein Function Cell surface receptor for LCN2 (24p3) that plays a key role in iron homeostasis and transport. Able to bind iron-bound LCN2 (holo-24p3), followed by internalization of holo-24p3 and release of iron, thereby increasing intracellular iron concentration and leading to inhibition of apoptosis.
Significance in milk involved in inflammatory conditions caused by bacteria
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZQ2|S22AH_BOVIN Solute carrier family 22 member 17 OS=Bos taurus OX=9913 GN=SLC22A17 PE=2 SV=1 MGSSLSLAVPPGPLSFEALLAQVGALGGGQQLQLGLCCLPVLFVALGLASDPIFTLAPPL HCHYGAFPPN*70ASGWEQPPN*79ASGVSVASAALAASAASRLATSTDPSCSGFAPPDFNHCLKD WDYNGLPVLTTNAIGQWDLVCDLGWQVILEQILFILGFASGYLFLGYPADRFGRRGIVLL TLGLVGPCGVGGAAAGSSTGVMALRFLLGFLLAGVDLGVYLMRLELCDPTQRLRVALAGE LVGVGGHFLFLGLALVSKDWRFLQRMITAPCILFLFYGWPGLFLESARWLIVKRQIEEAQ SVLRILAERNRPHGQMLGEEAQEALQDLENTCPLPATSSFSFASLLNYRNIWKNLLILGF TNFIAHAIRHCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSMT LTGIASLALLGLWDYLNEAAITTFSVLGLFSSQAAGILSTLLAAEVIPTTVRGRGLGLIM ALGALGGLSGPAQRLHMGHGAFLQHVVLAACALLCILSIMLLPETKRKLLPEVLRDGELC RRPSLLQQPPPNRCDHVPLLATPNPAL
Predicted Disorder Regions (71-80), (315-320), (542-567)
DisProt Annotation
TM Helix Prediction 11TMHs ; (147-169), (176-194), (200-222), (235-257), (266-284), (351 -369), (384- 406), (413-431), (440-462), (473-491) & (500-522)
Bibliography Wei, J., Gao, X., Qin, Y., Liu, T., & Kang, Y. (2020). An Iron Metabolism-Related SLC22A17 for the Prognostic Value of Gastric Cancer. OncoTargets and therapy, 13, 12763–12775. https://doi.org/10.2147/OTT.S287811