Search by BoMiProt ID - Bomi9312


Primary Information

BoMiProt ID Bomi9312
Protein Name Solute carrier family 2, facilitated glucose transporter member 3/Glucose transporter type 3, brain
Organism Bos taurus
Uniprot IdP58352
Milk FractionExosomes,MFGM
Aminoacid Length 494
Molecular Weight 54020
Fasta Sequence https://www.uniprot.org/uniprot/P58352.fasta
Gene Name SLC2A3
Protein Existence Status Reviewed

Secondary Information

Protein Function The glucose transporter 3 (GLUT3) is a high-affinity glucose transporter that is highly expressed in mammalian neurons.GLUT3 is also important for breast cancer cell survival and adaptation in the brain microenvironment and whether GLUT3 mediates cancer metabolic reprogramming.
PTMs Phosphorylation at Ser/Thr,N-linked Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus OX=9913 GN=SLC2A3 PE=2 SV=1 MGTTKVTAPLIFAISVATIGSFQFGYNTGVINAPEAIIKDFLN*43YTLEERSEPPPSSVLLT SLWSLSVAIFSVGGMIGSFSVGLFVNRFGRGNSMLIVNLLAIAGGCLMGFCKIAESVEML ILGRLIIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLKVILGT EDLWPLLLGFTILPAIIQCAALPFCPESPRFLLINRKEEEKAKEILQRLWGT*232EDVAQDIQ EMKDESMRMSQEKQVTVLELFRAPNYRQPIIISIMLQLSQQLSGINAVFYYSTGIFKDAG VQEPVYATIGAGVVNTIFTVVSVFLVERAGRRTLHLIGLGGMAFCSILMTISLLLKDN*358YS WMSFICIGAILVFVAFFEIGPGPIPWFIVAELFGQGPRPAAMAVAGCSNWTSNFLVGLLF PSAAFYLGAYVFIVFTVFLVIFWVFTFFKVPETRGRTFEEITRAFEGQTQTGTRGEKGPI MEMNS*585IQPTKDT*592NA
Predicted Disorder Regions 243-247, 467-494
DisProt Annotation
TM Helix Prediction 12 TMHs; (7-25),(62-84),(95-117),(121-143),(156-174),(183-205),(270-292),(304-326),(333-355),(359-377),(384-406),(425-447)
Additional Comments GLUT3 is highly overexpressed in brain metastatic breast cancers and mediates glucose metabolic reprogramming.
Bibliography 1.Kuo MH, Chang WW, Yeh BW, Chu YS, Lee YC, Lee HT. Glucose Transporter 3 is Essential for the Survival of Breast Cancer Cells in the Brain. Cells. 2019 Dec 4;8(12):1568. doi: 10.3390/cells8121568. PMID: 31817208; PMCID: PMC6952949.