Search by BoMiProt ID - Bomi9287


Primary Information

BoMiProt ID Bomi9287
Protein Name Sodium-driven chloride bicarbonate exchanger/Solute carrier family 4 member 10
Organism Bos taurus
Uniprot IdQ32LP4
Milk FractionWhey
Ref Sequence Id NP_001033217.1
Aminoacid Length 1117
Molecular Weight 125776
Fasta Sequence https://www.uniprot.org/uniprot/Q32LP4.fasta
Gene Name SLC4A10
Gene Id 517077
Protein Existence Status reviewed

Secondary Information

Protein Function Acts as Na+-coupled Cl−–HCO3 − exchanger.drastically reduces brain ventricle volume and protects against fatal epileptic seizures in mice.Also involved in control of neuronal pH and excitability and may contribute to the secretion of cerebrospinal fluid.
PTMs Glycosylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32LP4|S4A10_BOVIN Sodium-driven chloride bicarbonate exchanger OS=Bos taurus OX=9913 GN=SLC4A10 PE=2 SV=1 MQSGTCESFQSLSHQRNDEEAVVDRGGTRSILKTHFEKEDLEGHRTLFIGVHVPLGGRKS HRRHRHRGHKHRKRDRERDSGLEDGRES*88PSFDT*93PSQRVQFILGTEDDDEEHIPHDLFTEL DEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVLL DMHANTLEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQHHHQNQKKLTNRIPIVRSFAD IGKKQSEPNSMDKNAGQVVSPQSAPACVENKNDVS*275RENSTVDFSKGLGGQQKGHTSPCGM KQRHEKGPPHQQDREVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQGL AEVPIPTRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEFL DQVTVLPPGEWDPSIRIEPPKNVPSQEKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTGR LFGGLILDIKRKAPYFWSDFTDALSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISA IESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLWT ATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSEAYPINMHNDLEL LTQYSCNCVEPHN*673PSN*676NTLKEWRESN*686ISASDIIWEN*696LTVSECTSLHGEYVGRACGHEHPYVPDVLFWSVILFFSTVTLSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIGI PSPKLQVPSVFKPTRDDRGWFVTPLGPNPWWTVIAAIIPALLCTILIFMDQQITAVIINR KEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQP KFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQFFDRIKL FWMPAKHQPDFIYLRHVPLRKVHLFTVIQMSCLGLLWIIKVSRAAIVFPMMVLALVFVRK LMDFLFTKRELSWLDDLMPESKKKKLEDAEKEEEQS*1056MLAMEDEGTVQLPLEGHYRDDPSV INIS*1084DEMSKTALWRNLLITADNSKDKESSFPSKSSPS
Predicted Disorder Regions 1-10, 55-106, 259-267, 290-306, 466-472, 1052-1063, 1105-1117
DisProt Annotation
TM Helix Prediction 11TMH; (509-531), (544-566), ( 597-619), (626-644), (724-742), (762-780), (810-828), (848-870), (911-929), ( 936-954), (996-1018)