Search by BoMiProt ID - Bomi9278


Primary Information

BoMiProt ID Bomi9278
Protein Name Sodium/hydrogen exchanger 1/Na(+)/H(+) exchanger 1/Solute carrier family 9 member 1
Organism Bos taurus
Uniprot IdQ28036
Milk FractionWhey
Ref Sequence Id NP_777258.1
Aminoacid Length 817
Molecular Weight 91017
Fasta Sequence https://www.uniprot.org/uniprot/Q28036.fasta
Gene Name SLC9A1/NHE1
Gene Id 317654
Protein Existence Status reviewed

Secondary Information

Protein Function  plays an essential role in maintaining intracellular pH (pHi) homeostasis
PTMs Glycosylation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q28036|SL9A1_BOVIN Sodium/hydrogen exchanger 1 OS=Bos taurus OX=9913 GN=SLC9A1 PE=2 SV=1 MLLWPGASGLPPPRIFPSLLVVVALVGLLPVLRSYGLQISPTASTIRGSEPPRERSIGDV TTAPPELAPESRPVN*75HSFAEHSPKARKAFPVLGIDYQHVRIPFEIALWILLACLMKIGFH VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPILQSEVFFLFLLPPIILDAGYFLPLR QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLENLLFGSIISAVDPV AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYDRVGIVDIILGFLSFFV VSLGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG VVMRPYVEAN*370ISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPS*599A VS*602T*603VS*605MQNIHPKSLPAERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE EAWNQMLLRRQKARQLEQKISNYLTVPAHKLDS*693PTMS*697RARIGS*703DPLAYEPKADLPVITID PAS*723PQS*726PES*729VDLVNEELKGKVLGLSRDPGRLAEEEEDDNGPRWLTMRTKEPSSPGTDDVF TPAPSDS*787PSSQRIQRCLS*798DPGPHPEPGEGEPFIPKGQ
Predicted Disorder Regions 48-83, 687-817
DisProt Annotation
TM Helix Prediction 12TMHs; (15-37), (106-124), (128-146), (159-177), (189-211), (224-246), (255-277), (298-320), (339-361), (382-404), (413-435), (479-497)
Bibliography Song H, Yuan S, Zhang Z, Zhang J, Zhang P, Cao J, Li H, Li X, Shen H, Wang Z, Chen G. Sodium/Hydrogen Exchanger 1 Participates in Early Brain Injury after Subarachnoid Hemorrhage both in vivo and in vitro via Promoting Neuronal Apoptosis. Cell Transplant. 2019 Aug;28(8):985-1001. doi: 10.1177/0963689719834873. Epub 2019 Mar 6. PMID: 30838887; PMCID: PMC6728713.