Search by BoMiProt ID - Bomi9239


Primary Information

BoMiProt ID Bomi9239
Protein Name Small glutamine-rich tetratricopeptide repeat-containing protein alpha/Alpha-SGT
Organism Bos taurus
Uniprot IdQ32LM2
Milk FractionExosomes
Ref Sequence Id NP_001033119.1
Aminoacid Length 313
Molecular Weight 34213
Fasta Sequence https://www.uniprot.org/uniprot/Q32LM2.fasta
Gene Name SGTA
Gene Id 504701
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells cerebellum 
Protein Function Small glutamine-rich tetratricopeptide repeat-containing protein α (SGTA) has been implicated as a co-chaperone and regulator of androgen and growth hormone receptor (AR, GHR) signalling. 
Biochemical Properties  SGTA exhibits a central tandem array of 3 TPR motifs, a glutamine-rich C-terminal domain and an N-terminal domain containing a potential short coiled coil motif.SGTA is ubiquitously expressed in human and murine tissues, with M. musculus SGTA exhibiting 83% and 88% identity to human SGTA at the mRNA and protein levels, respectively, with similar distribution of functional domains
PTMs Phosphorylation at serine,N6-acetylation at Lysine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus OX=9913 GN=SGTA PE=2 SV=1 MDNKKRLAYAIIRFLHDQLRHGELSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPE IFEAAAAGKELPPDLRS*77PQET*81PPS*84EEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL NPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPSYSKAYGRMGLALSSLNKHTEAVA YYRKALELDPDNETYKSNLKVAELRLREAPSPTGGVGSFDIAGLLNNPSFMSMASNLMNN PQVQQLMSGMISGGHNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIR S*301RT*303PS*305ASNDDQQE
Predicted Disorder Regions 21-28, 48-97, 211-219, 242-313
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Philp LK, Day TK, Butler MS, Laven-Law G, Jindal S, Hickey TE, Scher HI, Butler LM, Tilley WD. Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein Alpha (SGTA) Ablation Limits Offspring Viability and Growth in Mice. Sci Rep. 2016 Jun 30;6:28950. doi: 10.1038/srep28950. PMID: 27358191; PMCID: PMC4928056. 2.Philp L. K. et al.. SGTA: A New Player in the Molecular Co-Chaperone Game. Horm Canc 4, 343–357, doi: 10.1007/s12672-013-0151-0 (2013).