Primary Information |
|---|
| BoMiProt ID | Bomi9239 |
|---|
| Protein Name | Small glutamine-rich tetratricopeptide repeat-containing protein alpha/Alpha-SGT |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q32LM2 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001033119.1 |
|---|
| Aminoacid Length | 313 |
|---|
| Molecular Weight | 34213 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SGTA |
|---|
| Gene ID | 504701 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | cerebellum |
|---|
| Protein Function | Small glutamine-rich tetratricopeptide repeat-containing protein α (SGTA) has been implicated as a co-chaperone and regulator of androgen and growth hormone receptor (AR, GHR) signalling. |
|---|
| Biochemical Properties | SGTA exhibits a central tandem array of 3 TPR motifs, a glutamine-rich C-terminal domain and an N-terminal domain containing a potential short coiled coil motif.SGTA is ubiquitously expressed in human and murine tissues, with M. musculus SGTA exhibiting 83% and 88% identity to human SGTA at the mRNA and protein levels, respectively, with similar distribution of functional domains |
|---|
| PTMs | Phosphorylation at serine,N6-acetylation at Lysine |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus OX=9913 GN=SGTA PE=2 SV=1
MDNKKRLAYAIIRFLHDQLRHGELSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPE
IFEAAAAGKELPPDLRS*77PQET*81PPS*84EEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL
NPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPSYSKAYGRMGLALSSLNKHTEAVA
YYRKALELDPDNETYKSNLKVAELRLREAPSPTGGVGSFDIAGLLNNPSFMSMASNLMNN
PQVQQLMSGMISGGHNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIR
S*301RT*303PS*305ASNDDQQE |
|---|
| Predicted Disorder Regions | 21-28, 48-97, 211-219, 242-313 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Philp LK, Day TK, Butler MS, Laven-Law G, Jindal S, Hickey TE, Scher HI, Butler LM, Tilley WD. Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein Alpha (SGTA) Ablation Limits Offspring Viability and Growth in Mice. Sci Rep. 2016 Jun 30;6:28950. doi: 10.1038/srep28950. PMID: 27358191; PMCID: PMC4928056. 2.Philp L. K. et al.. SGTA: A New Player in the Molecular Co-Chaperone Game. Horm Canc 4, 343–357, doi: 10.1007/s12672-013-0151-0 (2013). |
|---|
