Primary Information |
---|
BoMiProt ID | Bomi9228 |
---|
Protein Name | Small acidic protein |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q3MHL8 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001030551.1 |
---|
Aminoacid Length | 181 |
---|
Molecular Weight | 20108 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q3MHL8.fasta |
---|
Gene Name | SMAP |
---|
Gene Id | 616182 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Arf‐specific GTPase activating proteins,bind to Clathrin heavy chains and involved in the trafficking of clathrin‐coated vesicles |
---|
Biochemical Properties | LLGLD (aa 192–196) of SMAP1 and LLGLD (aa 187–191) and DLL (aa 212–214) of SMAP2 are thought to be responsible for the interaction with clathrin.Carboxy terminal region contains a unique abundance of Gln, Gly, Met, and Pro residues. |
---|
PTMs | Phosphorylation on Ser and Thr,Ubl conjugation,Acetylation on Lys. |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3MHL8|SMAP_BOVIN Small acidic protein OS=Bos taurus OX=9913 GN=SMAP PE=2 SV=1
MSAARESHPHGVKRS*15AS*17PDDDLGSSNWEAADLGNEERKQKFLRLMGAGKKEHTGRLVIGD
HKS*63TSHFRTGEEDKKINEELESQYQQS*87MDSKLSGRYRRHCGLGFSEVDDHDGEGDVAGDD
DDDDS*125PDPESPDDSESDSESEKEES*145TEELQAAEHPDEVEDSKNKKDAKSNYKMMFVKSSG
S |
---|
Predicted Disorder Regions | 1-181 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | Tanabe K, Kon S, Ichijo N, Funaki T, Natsume W, Watanabe T, Satake M. A SMAP gene family encoding ARF GTPase-activating proteins and its implication in membrane trafficking. Methods Enzymol. 2008;438:155-70. doi: 10.1016/S0076-6879(07)38011-7. PMID: 18413247. |