Search by BoMiProt ID - Bomi9228


Primary Information

BoMiProt ID Bomi9228
Protein Name Small acidic protein
Organism Bos taurus
Uniprot IdQ3MHL8
Milk FractionWhey
Ref Sequence Id NP_001030551.1
Aminoacid Length 181
Molecular Weight 20108
Fasta Sequence https://www.uniprot.org/uniprot/Q3MHL8.fasta
Gene Name SMAP
Gene Id 616182
Protein Existence Status reviewed

Secondary Information

Protein Function Arf‐specific GTPase activating proteins,bind to Clathrin heavy chains and involved in the trafficking of clathrin‐coated vesicles
Biochemical Properties LLGLD (aa 192–196) of SMAP1 and LLGLD (aa 187–191) and DLL (aa 212–214) of SMAP2 are thought to be responsible for the interaction with clathrin.Carboxy terminal region contains a unique abundance of Gln, Gly, Met, and Pro residues.
PTMs Phosphorylation on Ser and Thr,Ubl conjugation,Acetylation on Lys.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3MHL8|SMAP_BOVIN Small acidic protein OS=Bos taurus OX=9913 GN=SMAP PE=2 SV=1 MSAARESHPHGVKRS*15AS*17PDDDLGSSNWEAADLGNEERKQKFLRLMGAGKKEHTGRLVIGD HKS*63TSHFRTGEEDKKINEELESQYQQS*87MDSKLSGRYRRHCGLGFSEVDDHDGEGDVAGDD DDDDS*125PDPESPDDSESDSESEKEES*145TEELQAAEHPDEVEDSKNKKDAKSNYKMMFVKSSG S
Predicted Disorder Regions 1-181
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Tanabe K, Kon S, Ichijo N, Funaki T, Natsume W, Watanabe T, Satake M. A SMAP gene family encoding ARF GTPase-activating proteins and its implication in membrane trafficking. Methods Enzymol. 2008;438:155-70. doi: 10.1016/S0076-6879(07)38011-7. PMID: 18413247.