Search by BoMiProt ID - Bomi9207


Primary Information

BoMiProt ID Bomi9207
Protein Name SLAIN motif-containing protein 2
Organism Bos taurus
Uniprot IdQ3MHV6
Milk Fractionwhey
Ref Sequence Id NP_001030482.1
Aminoacid Length 582
Molecular Weight 62770
Fasta Sequence https://www.uniprot.org/uniprot/Q3MHV6.fasta
Gene Name SLAIN2
Gene Id 534203
Protein Existence Status Reviewed

Secondary Information

Protein Function Binds to the plus end of microtubules and regulates microtubule dynamics and microtubule organization. Promotes cytoplasmic microtubule nucleation and elongation. Required for normal structure of the microtubule cytoskeleton during interphase
PTMs Acetylation, Methylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3MHV6|SLAI2_BOVIN SLAIN motif-containing protein 2 OS=Bos taurus OX=9913 GN=SLAIN2 PE=2 SV=1 MEDVNSDVNADQEVRKLQELVKMLEKQNEQLRSRSGAVQGAGS*43FGPGS*48PVRAGASTPSSG TAS*63PRGFPLGLSAKSGSGAGSGPRRTS*88SEELRDATSLLAAGEGGLLDEVEPLRPEELERL SGWEEEEESWLYSS*134PKKKLTPMQKSVS*147PLVWCRQVLDYPS*160PDVECAKKSLIHKLDQTMS*179ALKRQNLYNNPFNSVSYTSPYSPNASSPYSSGFNSPSSTPVRPPIVKQLILPGNSGNLKSS SDRNPPLS*248PQS*251S*252IDS*255ELSASELDEDSIGSNYKLNDVTDVQILARMQEESLRQEYAATASRRSSGSSCNSTRRGTFS*316DQELDAQS*324LDDEDDNMHHAVYPAVNRFSPSPRNSPRPSPKQSPR NSPRSRSPARGIEYSRVS*378PQPMISRLQQPRLS*392LQGHPTDLQTTNVKNEEKLRRS*414LPNLSR TSNTQVDSVKSSRS*434DSNFQVPNGGIPRMQPQASAIPS*457PGKFRS*463PAAPS*468PLALRQPVKAFSNHGSGSPGSQETTQLMQTTSSPGPPMVQNTVPANPPSNINSTTLTRPAGTTVMRSGLPRP SAPSAGGIPVPRSKLAQPVRRSLPAPKTYGSMKDDSWKDGCY
Predicted Disorder Regions 17-33, 54-60, 75-82, 97-126, 138-145, 171-177, 188-209, 233-333, 499-502
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs  The highly phosphorylated form does not localize at microtubule plus ends and does not interact with MAPRE1 or CKAP5
Bibliography van der Vaart, B., Manatschal, C., Grigoriev, I., Olieric, V., Gouveia, S. M., Bjelic, S., Demmers, J., Vorobjev, I., Hoogenraad, C. C., Steinmetz, M. O., & Akhmanova, A. (2011). SLAIN2 links microtubule plus end-tracking proteins and controls microtubule growth in interphase. The Journal of cell biology, 193(6), 1083–1099. https://doi.org/10.1083/jcb.201012179