Search by BoMiProt ID - Bomi9190


Primary Information

BoMiProt ID Bomi9190
Protein Name Sin3 histone deacetylase corepressor complex component SDS3/Suppressor of defective silencing 3 protein homolog
Organism Bos taurus
Uniprot IdA6H6W9
Milk FractionWhey
Ref Sequence Id NP_001092361.1
Aminoacid Length 328
Molecular Weight 38133
Fasta Sequence https://www.uniprot.org/uniprot/A6H6W9.fasta
Gene Name SUDS3/SDS3
Gene Id 506646
Protein Existence Status reviewed

Secondary Information

Protein Function  functions to tether sequence-specific transcriptional repressors to histone deacetylase activity.appears to interact with the human Swi/Snf chromatin-remodeling complex,suggesting that the mSin3A complex may acquire chromatin-remodeling capacity via an indirect mechanism.
Biochemical Properties C-terminal region of mSin3 that is required for HDAC1 interaction known as histone deacetylase interaction domain (HID).
PTMs Acetylation, Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6H6W9|SDS3_BOVIN Sin3 histone deacetylase corepressor complex component SDS3 OS=Bos taurus OX=9913 GN=SUDS3 PE=2 SV=1 MSAAALLAPAPAPAGAPPAPEYYPEEDEELES*32AEDDERSCRGRES*45DEDT*49EDAS*53ETDLAKH DEEDFVEMKEQMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLE TEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPI MTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKS*228PKRPAS*334PSS*337PEH LPTT*344PAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVR KTSDSTKMRIYLGQLQRGLFVIRRRSAA
Predicted Disorder Regions 1-105, 137-141, 169-211, 218-261
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs 'Lys-63'-polyubiquitinated SUDS3 positively regulates histone deacetylation.
Bibliography Fleischer TC, Yun UJ, Ayer DE. Identification and characterization of three new components of the mSin3A corepressor complex. Mol Cell Biol. 2003 May;23(10):3456-67. doi: 10.1128/MCB.23.10.3456-3467.2003. PMID: 12724404; PMCID: PMC164750.