Primary Information |
---|
BoMiProt ID | Bomi9190 |
---|
Protein Name | Sin3 histone deacetylase corepressor complex component SDS3/Suppressor of defective silencing 3 protein homolog |
---|
Organism | Bos taurus |
---|
Uniprot ID | A6H6W9 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001092361.1 |
---|
Aminoacid Length | 328 |
---|
Molecular Weight | 38133 |
---|
FASTA Sequence |
Download |
---|
Gene Name | SUDS3/SDS3 |
---|
Gene ID | 506646 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | functions to tether sequence-specific transcriptional repressors to histone deacetylase activity.appears to interact with the human Swi/Snf chromatin-remodeling complex,suggesting that the mSin3A complex may acquire chromatin-remodeling capacity via an indirect mechanism. |
---|
Biochemical Properties | C-terminal region of mSin3 that is required for HDAC1 interaction known as histone deacetylase interaction domain (HID). |
---|
PTMs | Acetylation, Isopeptide bond formation, Phosphorylation, Ubl conjugation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A6H6W9|SDS3_BOVIN Sin3 histone deacetylase corepressor complex component SDS3 OS=Bos taurus OX=9913 GN=SUDS3 PE=2 SV=1
MSAAALLAPAPAPAGAPPAPEYYPEEDEELES*32AEDDERSCRGRES*45DEDT*49EDAS*53ETDLAKH
DEEDFVEMKEQMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLE
TEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPI
MTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKS*228PKRPAS*334PSS*337PEH
LPTT*344PAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVR
KTSDSTKMRIYLGQLQRGLFVIRRRSAA
|
---|
Predicted Disorder Regions | 1-105, 137-141, 169-211, 218-261 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | 'Lys-63'-polyubiquitinated SUDS3 positively regulates histone deacetylation. |
---|
Bibliography | Fleischer TC, Yun UJ, Ayer DE. Identification and characterization of three new components of the mSin3A corepressor complex. Mol Cell Biol. 2003 May;23(10):3456-67. doi: 10.1128/MCB.23.10.3456-3467.2003. PMID: 12724404; PMCID: PMC164750. |