Search by BoMiProt ID - Bomi9179


Primary Information

BoMiProt ID Bomi9179
Protein Name Signal transducer and activator of transcription 5A/Mammary gland factor
Organism Bos taurus
Uniprot IdQ95115
Milk FractionWhey
Ref Sequence Id NP_001012691.1
Aminoacid Length 794
Molecular Weight 90700
Fasta Sequence https://www.uniprot.org/uniprot/Q95115.fasta
Gene Name STAT5A/MGF
Gene Id 282375
Protein Existence Status reviewed

Secondary Information

Protein Function signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Binds to the GAS element and activates PRL-induced transcription. Regulates the expression of milk proteins during lactation.mediates the biological actions of members of the γ(c) family of cytokines in the immune system.
Significance in milk has a crucial role in the regulation of cell death during mammary gland involution.Regulates the expression of milk proteins during lactation
PTMs Phosphorylation on tyrosine and Serine.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q95115|STA5A_BOVIN Signal transducer and activator of transcription 5A OS=Bos taurus OX=9913 GN=STAT5A PE=2 SV=2 MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL LEGLVQELQKKAEHQVGEDGFLLKIKLGHY*90ATQLQNTYDRCPMELVRCIRHILYNEQRLV REANNGSS*128SAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS SSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL GDLNYLIYVFPDRPKDEVFSKY*682YTPVLAKAVDGY*694VKPQIKQVVPEFVSASADSAGSNATY MDQAPSPAVCPQPHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLEPSLP PPTGLFTPGRGSLS
Predicted Disorder Regions 2 predicted disordered segments;(712-750), (774-794)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Tyrosine phosphorylation is required for DNA-binding activity and dimerization.Serine phosphorylation is also required for maximal transcriptional activity