Search by BoMiProt ID - Bomi9178


Primary Information

BoMiProt ID Bomi9178
Protein Name Signal transducer and activator of transcription 3
Organism Bos taurus
Uniprot IdP61635
Milk FractionWhey,exosome
Ref Sequence Id NP_001012689.2
Aminoacid Length 770
Molecular Weight 87975
Fasta Sequence https://www.uniprot.org/uniprot/P61635.fasta
Gene Name STAT3
Gene Id 508541
Protein Existence Status Reviewed

Secondary Information

Protein Function As a transcription factor, STAT3 protein transduces extracellular signals to the nucleus and then activates transcription of target genes. STAT3 has been well validated as an attractive anticancer target due to its important roles in cancer initiation and progression. 
PTMs N-acetylation at Alanine,Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P61635|STAT3_BOVIN Signal transducer and activator of transcription 3 OS=Bos taurus OX=9913 GN=STAT3 PE=2 SV=1 MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQLLAPWIESQDWAYAASKESHATLVFHNL LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLLDDFDFNYKTLK SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST KPPGTCLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM DATNILVSPLVYLYPDIPKEDAFGKYCRPESQEHPEADPGSAAPY*705LKTKFICVT*714PTTCSN TIDLPMSPRTLDSLMQFGNNGEAAEPSAGGQFESLTFDMELTSECATSPM
Predicted Disorder Regions 124-133, 185-194, 742-747, 766-768
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Serine phosphorylation is important for the formation of stable DNA-binding STAT3 homodimers and maximal transcriptional activity.Phosphorylation at Tyr-705 by FER or PTK6 leads to an increase of its transcriptional activity.
Bibliography 1.Huang Q, Zhong Y, Dong H, Zheng Q, Shi S, Zhu K, Qu X, Hu W, Zhang X, Wang Y. Revisiting signal transducer and activator of transcription 3 (STAT3) as an anticancer target and its inhibitor discovery: Where are we and where should we go? Eur J Med Chem. 2020 Feb 1;187:111922. doi: 10.1016/j.ejmech.2019.111922. Epub 2019 Nov 28. PMID: 31810784.