Search by BoMiProt ID - Bomi9170


Primary Information

BoMiProt ID Bomi9170
Protein Name Signal peptidase complex subunit 3/Microsomal signal peptidase 22/23 kDa subunit/SPC22/23/SPase 22/23 kDa subunit
Organism Bos taurus
Uniprot IdQ3SZU5
Milk FractionWhey
Ref Sequence Id NP_001070461.1
Aminoacid Length 180
Molecular Weight 20313
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZU5.fasta
Gene Name SPCS3
Gene Id 767917
Protein Existence Status reviewed

Secondary Information

Protein Function is a subunit of the signal peptidase complex (SPC), which cleaves the signal sequences from secretory and membrane proteins during their transport into the lumen of the endoplasmic reticulum.
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZU5|SPCS3_BOVIN Signal peptidase complex subunit 3 OS=Bos taurus OX=9913 GN=SPCS3 PE=2 SV=1 MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRER SDLGFITFDITADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLL KDMKTKYFFFDDGNGLKGNRN*141VTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH; (13-31)
Bibliography Gao, Y., Jian, L., Lu, W., Xue, Y., Machaty, Z., & Luo, H. (2021). Vitamin E can promote spermatogenesis by regulating the expression of proteins associated with the plasma membranes and protamine biosynthesis. Gene, 773, 145364. https://doi.org/10.1016/j.gene.2020.145364